Beta-defensin 2, Human, Peptide - HC2140-50UG
HC2140 is a synthetic peptide and has the following sequence: H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH.
Quantity
50 µg
Catalog #
HC2140-50UG
347,00 €
Antimicrobial proteins (AMP) are a fundamental element of the primary response against pathogens. AMP’s are small endogenous cationic molecules expressed by phagocytic and epithelial cells. The antimicrobial activity of AMP’s is directed towards a broad spectrum of pathogens, like Gram-positive and -negative bacteria, viruses, yeast and fungi. AMP’s aid in innate immunity and adaptive immunity via direct inactivation and by immunomodulatory activity like leukocyte migration. Defensins are the most prominent mammalian AMP’s. Three defensin peptide families are identified, the α-, β-, and θ-defensins. They are characterized by a triple-stranded β-hairpin structure, six disulfide-linked cysteine residues and a positive charge. They are synthesized as preproteins and undergo processing to become a fully active peptide. Defensins are divided in alpha- and beta-defensins depending on their disulfide bridging pattern. Human beta-defensin-2 (hBD-2) is a cystein-rich cationic 41 amino acid antimicrobial peptide of 4-5 kDa. hBDs are localized in epithelial surfaces. Originally, hBD2 was identified in psoriatic scales. Nowadays, hBD-2 has been described as a dynamic component of the local epithelial defense system of the skin, intestinal and respiratory tract, where it functions by protecting surfaces from infection. The hBD2 gene is flanked by several binding sites of NF-kB. Its expression is inducible by proinflammatory molecules like TNFα, IL1α, diverse panel of bacteria, yeasts, IL22 and most of all by IL-17. hBD2 functions best under low ionic strength conditions and is weakened at high salt concentrations. hBD is capable of forming dimers and its microbial activity derives from the mechanism to permeabilize the anionic lipid bilayer, to form pores and the subsequent release of cellular content. HC2140 is a synthetic peptide and has the following sequence: H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH.
Datasheet URL | https://www.hycultbiotech.com/wp-content/uploads/2018/06/coa-tds_hc2140.pdf |
---|---|
Quantity | 50ug |
Quantity | 50 µg |
Species | human |
Alias | HBD2 |
Application | Functional studies, Western blot |
Precautions | For research use only. Not for use in or on humans or animals or for diagnostics. It is the responsibility of the user to comply with all local/state and federal rules in the use of this product. Hycult Biotech is not responsible for any patent infringements that might result from the use or derivation of this product. |
Application: | Functional studies Western blot |
---|