Life Science Products

catalog_no product_name HY-P1842 MAGE-A3 (195-203)
HY-D1030 Fluorescein Biotin HY-P1568A Flagelin 22 TFA
HY-D1027 Dansylcadaverine HY-P1241A BAM(8-22) TFA
HY-100041 Bromobimane HY-P1203 BIM-23056
HY-15937 5(6)-FAM SE HY-P1089 Cytochrome c-pigeon (88-104)
HY-136937 PYBG-TMR HY-P1037 Motilin (26-47), human, porcine
HY-101895 Fluorescein di(β-D-galactopyranoside) HY-P1185 Antagonist G
HY-112803 GNE-371 HY-P0196A Cholecystokinin Octapeptide, desulfated TFA
HY-D0055 3-Cyano-7-ethoxycoumarin HY-P1083 Dynamin inhibitory peptide
HY-D1026 CUG HY-P0306A Fibronectin Adhesion-promoting Peptide TFA
HY-15625 Hoechst 33258 analog 3 HY-P1255 Kinetensin
HY-15914 DHBS HY-P1929 Bivalirudin
HY-15559 Hoechst 33342 HY-P1522 β-Amyloid (29-40)
HY-102055 JAK2 JH2 Tracer HY-P1489 OVA Peptide(257-264)
HY-15907 BBD HY-P2468 BAD (103-127) (human)
HY-14536 Methylene Blue HY-P1466 β-Amyloid 1-16
HY-15939 6-FAM SE HY-P1183A Locustatachykinin I TFA
HY-D0831 WST-8 HY-P1347A RETF-4NA TFA
HY-135414B Cyanine5 NHS ester iodide HY-P1233A ANQ-11125 TFA
HY-128382 Brilliant Black BN HY-P1786 Allatostatin II
HY-15423 Dye 993 HY-P1594 Dynorphin A 1-10
HY-D0820 CY5-YNE HY-P2546 Biotin-Substance P
HY-D0342 Disperse Red 1 HY-P1210 Lys-γ3-MSH(human)
HY-D0996 LDS-751 HY-P2554 Histone H3 (1-25), amide
HY-P0019 Z-Gly-Gly-Arg-AMC HY-P2136 COG1410
HY-15422 Dye 937 HY-P2465 Histone H3 (1-35)
HY-D0974 Sulforhodamine B sodium salt HY-P1578 Galanin (1-16), mouse, porcine, rat
HY-123533 Resorufin HY-P1299A UFP-101 TFA
HY-B1422 9-Aminoacridine HY-P0242A Neurokinin B TFA
HY-D0023 Pyranine HY-P0256A Apamin TFA
HY-D0705 Acid Yellow 9 monosodium salt HY-P1205 MCH(human, mouse, rat)
HY-15562 HOE 32021 HY-P0006 Eledoisin
HY-15905 ALPS HY-P0098 [D-Ala2]leucine-enkephalin
HY-133852 FD-1080 HY-P2407 Fmoc-Ser(tBu)-Ser(psi(Me,Me)pro)-OH
HY-15938 5-FAM SE HY-P2788 Hyp-Phe-Phe
HY-D0042 NBD-Cl HY-111922 H-Gly-Gly-Pro-OH
HY-D0370 Solvent Yellow 16 HY-P1593A Mini Gastrin I, human TFA
HY-123630 Allura Red AC HY-P0274 PGLa
HY-15924 Thiazolyl Blue HY-P3066 SKF 100398
HY-15930A TMB dihydrochloride HY-P1306A Obestatin(rat) TFA
HY-128692 Lucifer Yellow CH dilithium salt HY-P2385 Fmoc-Val-Ser(psi(Me,Me)pro)-OH
HY-111382 Diphenylterazine HY-P1909 Casein Kinase Substrates 3
HY-101878 Sulforhodamine 101 HY-P1920 CEF19, Epstein-Barr Virus latent NA-3A (458-466)
HY-123533A Resorufin sodium salt HY-P0074 GPRP
HY-19204 Zinc phthalocyanine HY-P1804 SIYRY
HY-N7131 Coumarin 6 HY-P1771 OVA G4 peptide
HY-66021 6-FAM HY-P0240 Tuftsin
HY-111956 D-Ala-Lys-AMCA HY-P0301A SLLK, Control Peptide for TSP1 Inhibitor(TFA)
HY-131030 JF669, SE HY-P1071 α-CGRP(human)
HY-100575 Acriflavine HY-P1200 Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH
HY-D0048 5-TAMRA-SE HY-P2400 Fmoc-Leu-Thr(psi(Me,Me)pro)-OH
HY-15561 HOE-S 785026 HY-P1237 C-Type Natriuretic Peptide (CNP) (1-22), human
HY-15559A Hoechst 33342 trihydrochloride HY-P1774 Hepatitis B Virus Core (128-140)
HY-D0825 CY7 HY-P0319A 3X FLAG peptide TFA
HY-52112 BCDA HY-P1002 Suc-Leu-Leu-Val-Tyr-AMC
HY-D0925 Cy5.5-SE HY-P1515 Angiotensin II (3-8), human
HY-W013275 MCLA hydrochloride HY-P1573 Brain Natriuretic Peptide-45, rat
HY-100335 PCI-33380 HY-P1115A AKTide-2T TFA
HY-D0098 Fluorescein-5-maleimide HY-P2381 TRV120055
HY-D0971 Pyronin Y HY-P0315 Crosstide
HY-D0021 Ethidium bromide HY-P0236A Neurokinin A(4-10) TFA
HY-D0249 Sunset Yellow FCF HY-P1463A Calcitonin, eel TFA
HY-D0169A Phenol Red sodium salt HY-P0215 Autocamtide-2-related inhibitory peptide, myristoylated
HY-D0987 Stains-All HY-P2318 Bac2A TFA
HY-D0079 Dihydroethidium HY-P1791 Lactoferrin (17-41)
HY-D0822 CY3 HY-P2526 LyP-1
HY-D0376 Solvent Yellow 93 HY-P2529 Penetratin
HY-111377 Amine-PEG3-Biotin HY-P1872 OV-1, sheep
HY-Y0016 Rhodamine B HY-N6693 Valinomycin
HY-D0993 Acridine Orange 10-Nonyl Bromide HY-P2273 Calcitonin (human)
HY-D0256A Direct Black 38 free acid HY-A0261 Pentagastrin
HY-15922A Luminol sodium salt HY-P2453 MBP (90-106)
HY-15619 Hoechst S 769121 HY-P1249 Neuropeptide SF(mouse,rat)
HY-D0827 Cy2 HY-P2310 Defensin HNP-1 human
HY-12591A D-Luciferin HY-P1179 Guanylin(human)
HY-15935 X-Gluc Dicyclohexylamine HY-P0138 MART-1 (26-35) (human)
HY-15931 TMB-PS HY-P1764 Secretoneurin, rat
HY-118562 Dansylamide HY-P1767 Prepro VIP (81-122), human
HY-D0985A TMRE HY-P2516 Tau Peptide (275-305) (Repeat 2 domain)
HY-D1151 HKOH-1 HY-P0308 [Glu1]-Fibrinopeptide B
HY-D1071 DBCO-PEG12-TCO HY-P1302 Orphanin FQ(1-11)
HY-D0006 Bathophenanthroline HY-P1185A Antagonist G TFA
HY-D0715 Fluorescamine HY-P2358 PSMα3
HY-111653 CycLuc1 HY-P1845A PACAP-38 (31-38), human, mouse, rat TFA
HY-50938 D149 Dye HY-P1903 β-Amyloid (35-42)
HY-D0995 7-Methyl-6-thioguanosine HY-P1027 LEP(116-130)(mouse)
HY-D0717 DAF-FM DA HY-P1316A Ac-RYYRWK-NH2 TFA
HY-D0802 Biotin NHS HY-P1815 C-Type Natriuretic Peptide (1-53), human
HY-111956B D-Ala-Lys-AMCA hydrochloride HY-P0309A Arg-Gly-Glu-Ser TFA
HY-15942 5-TAMRA HY-P1240 Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat
HY-D0994 4-Methylumbelliferyl phosphate HY-P0240A Tuftsin diacetate
HY-D0053 6-ROX HY-16959 CEP dipeptide 1
HY-D0049 6-TAMRA-SE HY-P2494 OVA (55-62)
HY-15560 Hoechst 34580 HY-P0149A Katacalcin TFA
HY-D0903 DFO HY-P0090 Calcitonin (salmon)
HY-130027 HKOCl-4 HY-P1293 Conantokin G
HY-15928 PNPP HY-P1494 Substance P (1-9)
HY-U00451 ATP-Red 1 HY-P1019A [Ala1,​3,​11,​15]​-​Endothelin (53-63) (TFA)
HY-129811 Bis-ANS dipotassium HY-P1545 ACTH (1-17)
HY-D0807 5-IAF HY-P1548A β-CGRP, human TFA
HY-N0116 Hematoxylin HY-P1028A Hexa-D-arginine TFA
HY-N6646 Safflower red HY-129034 Ramoplanin
HY-101882 BCECF HY-P1229 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-130768 N-(Azido-PEG3)-N-Fluorescein-PEG3-acid HY-P1889A Bim BH3, Peptide IV TFA
HY-15630A Hoechst 33342 analog 2 trihydrochloride HY-P2491 Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled
HY-D0211 Phenolphthalein HY-P0196 Cholecystokinin Octapeptide, desulfated
HY-108166A Hydroxystilbamidine bis(methanesulfonate) HY-P1861 Interphotoreceptor Retinoid Binding Protein Fragment (IRBP)
HY-P1003 Ac-DEVD-AMC HY-P1223 Exendin-3/4 (59-86)
HY-D1228 Pigment Red 22 HY-P1286A PKC β pseudosubstrate TFA
HY-101900 Nile Blue A sulfate HY-P1369 DynaMin inhibitory peptide, myristoylated
HY-101880 ADHP HY-P1542B Urotensin I TFA
HY-D0722 5(6)-CFDA HY-P3103 PINT-87aa
HY-15630 Hoechst 33342 analog 2 HY-P1235A Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate
HY-130015 HKSOX-1 HY-P0149 Katacalcin
HY-12591B D-Luciferin potassium salt HY-P2459 MOG (35-55), human
HY-12591 D-Luciferin sodium salt HY-P1483B Urotensin II, mouse acetate
HY-101893 Dihydrofluorescein diacetate HY-P0203A α-CGRP, rat TFA
HY-15930C TMB monosulfate HY-P1727 Super-TDU
HY-D1148 HKGreen-4I HY-P2503 EGFR Protein Tyrosine Kinase Substrate
HY-D0040 Calcein HY-P0122B iRGD peptide 1 TFA
HY-D0720 Lucigenin HY-P2355A {Boc}-Phe-Leu-Phe-Leu-Phe TFA
HY-D0012 Bromothymol Blue HY-P1314A 2-Furoyl-LIGRLO-amide TFA
HY-D1048 Cy7 DiC18 HY-P1375 [D-Trp7,9,10]-Substance P
HY-D0828 3,6-Dichlorotrimellitic acid HY-P2219A CGGRGD TFA
HY-D0826 Cy2-SE (iodine) HY-P1800 Caerulein, desulfated
HY-15631 Hoechst 33258 analog 6 HY-P1487 Pressinoic Acid
HY-15558A Hoechst 33258 trihydrochloride HY-P1082 Gap 26
HY-131010 Flutax-2 HY-P1782 Calcitonin (8-32), salmon
HY-15561B HOE-S 785026 trihydrochloride HY-P1208 PG-931
HY-130022 HKPerox-1 HY-P1490 Bradykinin (2-9)
HY-D0797 Azomethine-H monosodium HY-P1571A Nucleoprotein (396-404) (TFA)
HY-D0989 Rhod-2 AM HY-P1267A α-Conotoxin PnIA TFA
HY-15560B Hoechst 34580 tetrahydrochloride HY-P0018A Pepstatin Trifluoroacetate
HY-15934 X-GAL HY-P1250A RFRP-3(human) TFA
HY-128536 KMG-104AM HY-P1004 Luciferase
HY-15925 Nitro blue tetrazolium chloride HY-P1217 [D-Trp8]-γ-MSH
HY-D0983 Trypan red HY-P1236 Atrial Natriuretic Peptide (ANP) (1-28), rat
HY-D0908 Ninhydrin HY-P0007 Elcatonin
HY-15626 ortho-iodoHoechst 33258 HY-P1445 HAEGTFTSDVSSYLE
HY-D0226 Quinizarin HY-P1399 Pep2m, myristoylated
HY-15627 Hoechst 33342 analog HY-P1739 ACTH (34-39)
HY-136277 DFHO HY-P0003 Nesiritide
HY-D1118 BODIPY 576/589 HY-P1310A VKGILS-NH2 TFA
HY-D0936 SPQ HY-P1208A PG-931 TFA
HY-D0036 Br-Mmc HY-P1263 tcY-NH2
HY-101937B L-ANAP hydrochloride HY-P1289C [Ala113]MBP(104-118) TFA
HY-D0816 Rhodamine 123 HY-P1220 Huwentoxin-IV
HY-15902 ABTS diammonium salt HY-P1874 Calmodulin-Dependent Protein Kinase II (281-309)
HY-15940 5(6)-Carboxyfluorescein HY-P0058A Pramlintide TFA
HY-D0086 DIDS sodium salt HY-P1576 AMARA peptide
HY-66022 5-FAM HY-P2279 Parathyroid hormone (1-34) (rat)
HY-D0022A 6-Aminofluorescein HY-P0055 GLP-1(7-37)
HY-D1050 DNP-X, SE HY-P1771A OVA G4 peptide TFA
HY-103470 K114 HY-P0189A ω-Conotoxin GVIA TFA
HY-D0300 Leucomalachite green HY-P1248 Neuropeptide FF
HY-135414 Cyanine5 NHS ester chloride HY-P2213A GPLGIAGQ TFA
HY-136936 PYBG-BODIPY HY-P1083A Dynamin inhibitory peptide TFA
HY-D1044 Rhodamine 101 chloride HY-P0111 Z-WEHD-FMK
HY-D0718 Nile Red HY-P2141A TRV-120027 TFA
HY-D0029 5(6)-Aminofluorescein HY-P0268 Myomodulin
HY-114879 DDAO HY-P1030 Hemokinin 1 (mouse)
HY-P0021 D-Lys(Z)-Pro-Arg-pNA HY-P0220A PACAP (6-38), human, ovine, rat TFA
HY-D1112 TFAX 546,SE triethylammonium HY-P0278A RGD Trifluoroacetate
HY-133527 OG 488, SE HY-P1355 Cyclosporin A-Derivative 1
HY-D0162 Malachite green oxalate HY-P0178 LXW7
HY-D0145 7-Ethoxyresorufin HY-P1948A Thioredoxin reductase peptide TFA
HY-W040226 Indigo carmine HY-P2390 Fmoc-Leu-Ser(psi(Me,Me)pro)-OH
HY-15629 HOE 32020 HY-P0316 TP508
HY-D0984 TMRM HY-P1355A Cyclosporin A-Derivative 1 Free base
HY-133705 Geldanamycin-FITC HY-P0271A Syntide 2 TFA
HY-D1156 HKSOX-1m HY-P1303A CART(62-76)(human,rat) TFA
HY-101890 Dabsyl chloride HY-P0176A PACAP (1-27), human, ovine, rat TFA
HY-101876 Rhodamine 800 HY-P1829 Angiotensin I/II (1-6)
HY-101891 Di-8-ANEPPS HY-P1319A Nociceptin(1-7) TFA
HY-D0716 Fluo-3AM HY-P1374 SYSMEHFRWGKPS
HY-15534 JC-1 HY-P2293 Luteinizing hormone (human)
HY-D0853A H-L-Photo-lysine hydrochloride HY-P1886 Kv3, Channel Containing Protein (567-585)
HY-N0938 Safflower yellow HY-114161A H-Val-Pro-Pro-OH TFA
HY-101897 Fura-2 AM HY-P1279A [Lys5,MeLeu9,Nle10]-NKA(4-10) TFA
HY-D0913 1-Methyl-7-nitroisatoic anhydride HY-P0209 Rat CGRP-(8-37)
HY-128868 FITC-Dextran (MW 10000) HY-P1063 LF11
HY-B0883 Proflavine hemisulfate HY-P1066 Apelin-17(human, bovine)
HY-D0785 NBD-F HY-P1860A TNF-α (31-45), human TFA
HY-125815 Reactive Blue 4 HY-P1901 Insulin alpha-chain (1-13)
HY-15944 5(6)-TAMRA HY-P1143A [Des-His1,Glu9]-Glucagon amide TFA
HY-D1114 TFAX 488,SE dilithium HY-P0327 T7 Tag Peptide
HY-D0090 MQAE HY-P1220A Huwentoxin-IV TFA
HY-101937C (±)-ANAP hydrochloride HY-P1318A Ac-RYYRIK-NH2 TFA
HY-15909 BCIP HY-P1184A HNGF6A TFA
HY-D0251 Fluorescein HY-P1559A GRGDSPC TFA
HY-15903 ADOS HY-P3137 TRV056
HY-D0073 2,3-Diaminonaphthalene HY-P1259A PR-39 TFA
HY-D0932 Sudan IV HY-P1585 Gp100 (25-33), human
HY-P1448 Ac-Leu-Arg-AMC HY-P0018B Pepstatin Ammonium
HY-D0236 Congo Red HY-133026 N-Acetylcarnosine
HY-D1158 HKOCl-4m HY-P1516 Angiogenin 108-122
HY-D1195 Vat Blue 2 HY-P0002 Protirelin
HY-D0921 Heptamethine cyanine dye-1 HY-P1582A ACTH (1-14) (TFA)
HY-D0122 6-Iodoacetamidofluorescein HY-P1904 Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa
HY-D0167 NHS-5(6)Carboxyrhodamine HY-P2510 Parathyroid Hormone (1-34), human, biotinylated
HY-D0935A 4-Methylumbelliferyl-β-D-glucuronide hydrate HY-P1907 Human Papillomavirus (HPV) E7 protein (49-57)
HY-B1539A Fuchsine base monohydrochloride HY-108795A Albiglutide TFA
HY-D0024 Sudan I HY-P1077 CALP1
HY-D0168 Orcinol HY-P1807 Mast Cell Degranulating Peptide HR-2
HY-130013 HKYellow-AM HY-P3101A GLP-1(28-36)amide TFA
HY-101901 Oxazine 1 perchlorate HY-12290A Arg-Gly-Asp-Ser (TFA)
HY-D0218 Thioflavin T HY-108741 Plecanatide
HY-D0981 7-Amino-4-(trifluoromethyl)coumarin HY-P1378 Amyloid β-Peptide(1-43)(human)
HY-B0324A Crystal Violet HY-P1225 {Val1}-Exendin-3/4
HY-15943 6-TAMRA HY-P1243 C3bot(154-182)
HY-D0830 Calcein tetraethyl ester HY-P1349 Orexin B, rat, mouse
HY-107967 Isosulfan blue HY-105858 BNC210
HY-D0257 Tartrazine HY-P0019A Z-Gly-Gly-Arg-AMC acetate
HY-D0784 5-ROX HY-P1033 [Pyr1]-Apelin-13
HY-D1049 DNP-X acid HY-P1902A Cardiotoxin Analog (CTX) IV (6-12) (TFA)
HY-D0982 Zinquin HY-P1812 AUNP-12
HY-66020 6-FITC HY-P0226A TFLLR-NH2(TFA)
HY-D0924 Cy5.5 HY-P2408 Fmoc-Trp(Boc)-Thr(psi(Me,Me)pro)-OH
HY-D0032 DAF-2DA HY-P2093A S961 TFA
HY-D0017 Dansyl chloride HY-P2008 Boc-Ile-Glu-Gly-Arg-AMC
HY-16710 GPDA HY-P1819 N-Acetyl-α-Endorphin
HY-15623 Hoechst 33258 analog HY-P1594A Dynorphin A (1-10) (TFA)
HY-P0021A D-Lys(Z)-Pro-Arg-pNA diacetate HY-P1051 β-amyloid (12-28)
HY-101889 Cresyl Violet perchlorate HY-P1766 Adrenomedullin (11-50), rat
HY-101879 Acridine Orange hydrochloride HY-P2558 GSK3 Substrate, α, β subunit
HY-D0915 Brilliant Blue FCF HY-P1104A FC131 TFA
HY-D0939 Direct Blue 1 HY-P2290A Beta-defensin 1, pig TFA
HY-D0022 5-Aminofluorescein HY-P1932A Cortistatin-14 TFA
HY-101902 Quin-2AM HY-P1320 [Nphe1]Nociceptin(1-13)NH2
HY-101896 Fluo-4 AM HY-P0194 NocII
HY-D0914 Fast Green FCF HY-P1111A Lyn peptide inhibitor TFA
HY-D0004 Azure B HY-P2518 Protease-Activated Receptor-1, PAR-1 Agonist
HY-B1571 Bromophenol blue HY-P0275 Proctolin
HY-D0824 CY7-SE HY-P0266A N-Acetyl-Ser-Asp-Lys-Pro TFA
HY-101892 DiBAC4(3) HY-P3136 TRV055
HY-D0893 NSP-SA-NHS HY-P1457 Adrenomedullin (AM) (13-52), human
HY-B0961 Merbromin HY-P1897 Fibronectin Active Fragment Control
HY-D0306 Tris(4-aminophenyl)methane HY-P0191A Charybdotoxin TFA
HY-D0193 Ponceau 4R HY-16465A IRL-1620 TFA
HY-D0083 DiI HY-P0137 CEF1, Influenza Matrix Protein M1 (58-66)
HY-D0711 Cardiogreen HY-P1239A Neuromedin S(rat) TFA
HY-D0969 3,3'-Dioctadecyloxacarbocyanine perchlorate HY-P0197A Neurokinin A TFA
HY-P1005 Ac-DEVD-AFC HY-P1629 Temporin A
HY-D0516 Solvent Blue 35 HY-P1566 MPG, HIV related
HY-D0965 Procion Blue HB HY-105069A Rusalatide acetate
HY-129042 Cibacron Blue 3G-A HY-P1422A Spadin TFA
HY-D1157 HKPerox-2 HY-P1198 Hemokinin 1, human
HY-D1068 Cy5-DBCO HY-P0285 Rabies Virus Glycoprotein
HY-117695 AQC HY-P1202 CYN 154806
HY-136247 Cyanine 5 Tyramide HY-P0285A Rabies Virus Glycoprotein TFA
HY-B1046 Clofazimine HY-107024 Osteogenic Growth Peptide (10-14)
HY-D1054 Cy2 (iodine) HY-P0278 RGD
HY-130017 HKSOX-1r HY-P0084 Cyclic somatostatin
HY-P1002 Suc-Leu-Leu-Val-Tyr-AMC HY-P1479A Calmodulin-Dependent Protein Kinase II(290-309) acetate
HY-133532 PB succiniMidyl ester HY-P1954A Piscidin-1 (22-42) (TFA)
HY-136213 Endoplasmic reticulum dye 1 HY-P1048 Myelin Basic Protein (MBP) (68-82), guinea pig
HY-128868A FITC-Dextran (MW 4000) HY-P2538 Big Endothelin-1 (1-38), human
HY-D0814 DAPI dihydrochloride HY-P1949A Cyclic MKEY TFA
HY-D1270 Direct Violet 1 HY-P0092 Cecropin B
HY-D0940 H2DCFDA HY-P0085 Splenopentin diacetate
HY-D0721 6-CFDA HY-P1232 HAE
HY-108715 Real Thiol HY-P2237 Boc-Leu-Gly-Arg-AMC
HY-15622 meta-iodoHoechst 33258 HY-P1523 Leptin (22-56), human
HY-U00440 FHZ HY-P1382A Rac1 Inhibitor W56 TFA
HY-D0821 CY5 HY-P1858 Urocortin III, mouse
HY-D0970 Diphenyl Blue HY-P0317 Interleukin (IL)-6 Receptor
HY-101883 BCECF-AM HY-P1183 Locustatachykinin I
HY-N0335 Indigo HY-P1535 Secretin, porcine
HY-12489 Ponceau S HY-P1791B Lactoferrin (17-41) (acetate)
HY-D0259 Erythrosine B HY-P2039 Retrobradykinin
HY-P1004 Luciferase HY-P2456 MBP MAPK Substrate
HY-18743 Coelenterazine HY-P1746 Protein Kinase C (19-31)
HY-15941 5(6)-FITC HY-P1944A Apelin-13 TFA
HY-D0165 Naphthoresorcinol HY-P1282A Agitoxin-2 TFA
HY-128369 Acid Yellow 36 HY-P2695 STh
HY-D0233 Leucocrystal violet HY-P1866 β-Endorphin, equine
HY-D0047 5-CFDA HY-P0173A Chlorotoxin
HY-103311 Ruthenium red HY-P1329 CTOP
HY-D0815 Propidium Iodide HY-P1781A Peptide C105Y TFA
HY-D0986 TMA-DPH HY-P0173 Chlorotoxin(linear)
HY-D0968 Cy 3 Non-Sulfonated HY-P1501 δ-Sleep Inducing Peptide
HY-D0043 5(6)-ROX HY-P1334 DPDPE
HY-D0938 CFSE HY-P1840A Galanin Receptor Ligand M35 TFA
HY-131029 JF646, Maleimide HY-P1877 SV40 T-Ag-derived NLS peptide
HY-111391 Resazurin sodium HY-P2254 H3K27(Me3) (15-34)
HY-15621A DMA trihydrochloride HY-P0288 [Leu5]-Enkephalin
HY-123749 Tetramethylrhodamine-5-iodoacetamide HY-P1881 HPV16-E711-20 epitope
HY-130025 HKOCl-3 HY-106783 Polymyxin B nonapeptide
HY-101888 Cresyl Violet acetate HY-P1751 Ceratotoxin B
HY-15628 Hoechst 33258 analog 5 HY-P1214A γ1-MSH TFA
HY-D1159 HKOH-1r HY-P2155 BigLEN(rat)
HY-P0019A Z-Gly-Gly-Arg-AMC acetate HY-P2513 Src Optimal Peptide Substrate
HY-D0829 3,6-Dichlorotrimellitic anhydride HY-P1389 Neuropeptide S (human)
HY-D0150 Thiazole Orange HY-P1242 NEP(1-40)
HY-D1106 Py-BODIPY-NHS ester HY-P1159 [D-p-Cl-Phe6,Leu17]-VIP
HY-D1028 DiD perchlorate HY-P1825 TNF-α (10-36), human
HY-D1042 1,4-Dichloro 5-carboxytetramethylrhodamine HY-108896 Icatibant acetate
HY-15624 Hoechst 33258 analog 2 HY-P0195 Bombesin
HY-D0003 Methyl Blue HY-P0198 Neuropeptide Y (29-64), amide, human
HY-101899 Monochlorobimane HY-P2321A TRAP-6 amide TFA
HY-D0801 Calmagite HY-P1959A Lanreotide acetate
HY-15632 para-iodoHoechst 33258 HY-P0235 CDK2
HY-101898 Indo-1 AM HY-P1541 Motilin, canine
HY-D0307A Amaranth HY-P2500 (Arg)9, FAM-labeled
HY-100512 Benzenepentacarboxylic Acid HY-P1284 ZIP
HY-D0027 7-Amino-4-methylcoumarin HY-P1529 Thyrotropin-Releasing Hormone (TRH), Free Acid
HY-D0984A TMRM Perchlorate HY-P0023A Cyclo(-RGDfK) TFA
HY-D1045 Dabcyl acid HY-P1555 ACTH 1-13
HY-D0144 Resorufin methyl ether HY-P1020A Nocistatin(human) TFA
HY-111496 Sulfo-NHS-SS-Biotin sodium HY-P1579 TAT 2-4
HY-101887 Calcein Blue HY-P1473 Amylin (8-37), rat
HY-103594 2-Aminoacridone HY-P1259 PR-39
HY-112276 Beryllon II HY-P1256 JMV 449
HY-128448 Carmoisine HY-P1067A Enterostatin(human,mouse,rat) TFA
HY-D0214 Rose Bengal sodium HY-P2260 Tat-beclin 1
HY-112641A AkaLumine hydrochloride HY-P1583 MARK Substrate
HY-D1110 TFAX 594,SE HY-P2498 Cathepsin D and E FRET Substrate
HY-D1020 7-Aminoactinomycin D HY-P1460 His-[D-2-ME-Trp]-Ala
HY-15922 Luminol HY-P0249A Phe-Met-Arg-Phe amide trifluoroacetate
HY-D0147 Resorufin pentyl ether HY-P2540 Leptin (93-105), human
HY-P1004A Luciferase, firefly HY-P1321A GR231118 TFA
HY-D1111 TFAX 568, SE HY-P1035 Neuropeptide W-23(human)
HY-101859 NucPE1 HY-P1569A LCMV gp33-41 TFA
HY-D0084 3,3'-Dihexyloxacarbocyanine iodide HY-P1788 Influenza A NP(366-374) Strain A/PR/8/35
HY-D0931 Sudan III HY-P1778A HPV16 E7 (86-93) (TFA)
HY-D1069 DBCO-Cy3 HY-106783A Polymyxin B nonapeptide TFA
HY-D0972 Thioflavine S HY-P1463 Calcitonin, eel
HY-P2536 Mca-Ala-Pro-Lys(Dnp)-OH HY-P1084A β-Pompilidotoxin TFA
HY-D0818 CY3-YNE HY-P2322 Iturin A
HY-66019 FITC HY-P1078A Huwentoxin XVI TFA
HY-15621 DMA HY-P0131 Laminin (925-933)
HY-135009 2-Di-1-ASP HY-P2283 Amyloid β-Peptide (1-37) (human)
HY-136248 Cyanine 3 Tyramide HY-P1204 [Ala17]-MCH
HY-D0817 Rhodamine 110 HY-P2393 Fmoc-Val-Thr(psi(Me,Me)pro)-OH
HY-15096 MKT-077 HY-P0290A GRGDSP TFA
HY-D0955 Thionin acetate HY-P1038A [SER140]-PLP(139-151) TFA
HY-101937 L-ANAP HY-P0203 α-CGRP, rat
HY-D0080 Laurdan HY-P1868 α2β1 Integrin Ligand Peptide
HY-15558 Hoechst 33258 HY-P1195A PDZ1 Domain inhibitor peptide TFA
HY-D0309 Rhodamine 6G HY-P2787 Pro-Phe-Phe
HY-D0256 Direct Black 38 HY-P0052 Enfuvirtide
HY-15930 TMB HY-P1806A Gastrin I (1-14), human TFA
HY-D1046 Dabcyl acid, SE HY-P2512 Phytochelatin 2 (PC2)
HY-101894 Dihydrorhodamine 123 HY-P1518 Adrenocorticotropic Hormone (ACTH) (1-10), human
HY-116215 2-NBDG HY-P1297A CRF(6-33)(human) TFA
HY-D0723 5(6)-TAMRA SE HY-P2343 BH3 hydrochloride
HY-D0853 H-L-Photo-lysine HY-P1456 Adipokinetic Hormone (AKH) (24-32), locust
HY-D0041 Calcein-AM HY-P0273A Histatin 5 TFA
HY-D0824A CY7-SE triethylamine HY-P1410A GsMTx4 TFA
HY-D1113 TFAX 488,TFP HY-P0301 SLLK, Control Peptide for TSP1 Inhibitor
HY-B1273 Fenipentol HY-P1004A Luciferase, firefly
HY-P2405 Fmoc-Gly-Ser(psi(Me,Me)pro)-OH HY-P1084 β-Pompilidotoxin
HY-P1827 mTRP-2 (180-188) HY-P1803 Protein Kinase C Peptide Substrate
HY-P2474 Human PD-L1 inhibitor I HY-P1734 Ac-MBP (1-11)
HY-P3108 Alamandine HY-P1825A TNF-α (10-36), human TFA
HY-A0182A Felypressin acetate HY-P1416A Foxy-5 TFA
HY-P1467A [Met5]-Enkephalin, amide TFA HY-P2632 RAD16-I
HY-128434 L-​Leucyl-​L-​alanine HY-P0280 MUC5AC motif peptide
HY-P2403 Fmoc-Asp(OtBu)-Ser(psi(Me,Me)pro)-OH HY-P1080 ω-Agatoxin IVA
HY-P1333 Dynorphin A HY-P1967 Ac-VDID TFA
HY-P0260 p2Ca HY-P1222A LL-37, human TFA
HY-P0214 Autocamtide-2-related inhibitory peptide HY-P1159A [D-p-Cl-Phe6,Leu17]-VIP TFA
HY-P2545 [Tyr1]-Somatostatin-14 HY-P1271 Catestatin
HY-114424A H-Ile-Pro-Pro-OH hydrochloride HY-P1587 IRBP (1-20), human
HY-P3102 GLP-1(32-36)amide HY-P0030 5-Tamra-DRVYIHP
HY-P1267 α-Conotoxin PnIA HY-P1577 Dermorphin Analog
HY-P0267 Melanotan (MT)-II HY-P1773 IGF-I (30-41)
HY-P0284 C-telopeptide HY-P1323A [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA
HY-P1131A M617 TFA HY-P2472 Orphan GPCR SP9155 agonist P550 (mouse, rat)
HY-P1987 Mast cell degranulating peptide (28-49) HY-P0233 Melittin
HY-P1564 [Sar1, Ile8]-Angiotensin II HY-P1337A Dynorphin B (1-13) (TFA)
HY-P1378A Amyloid β-Peptide(1-43)(human) TFA HY-P1481A β-Casomorphin, human TFA
HY-106263B Tyroserleutide hydrochloride HY-P1770 Adrenomedullin (16-31), human
HY-P1453A CMD178 TFA HY-P1885 HIV gag peptide (197-205)
HY-P2352 Fetuin, Fetal Bovine Serum HY-P1187 HSDVHK-NH2
HY-P0123 SPACE peptide HY-P2536 Mca-Ala-Pro-Lys(Dnp)-OH
HY-P1314 2-Furoyl-LIGRLO-amide HY-P2527 Tyrosinase-related Protein 2 (TRP-2) (181-188)
HY-P1449 Boc-Gly-Gly-Phe-Gly-OH HY-P1799A [pTyr5] EGFR (988-993) (TFA)
HY-P1076A CALP2 TFA HY-P1517 β-Amyloid (31-35)
HY-P1810 c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm HY-P2291A Beta-defensin 103 isoform X1, pig TFA
HY-P1857 CEF7, Influenza Virus NP (380-388) HY-P0259 Xenin
HY-P1335 CTAP HY-P1298 Sauvagine
HY-P0069A L-JNKI-1 HY-P1830 β-Casomorphin (1-5), amide, bovine
HY-P1067 Enterostatin(human,mouse,rat) HY-P0233A Melittin TFA
HY-P1021A Peptide YY (PYY) (3-36), human TFA HY-P1514 Peptide YY (PYY), human
HY-106377A BIO-11006 acetate HY-P0263 Dermaseptin
HY-P1474 β-Amyloid (22-35) HY-P1575A TAT (48-57) (TFA)
HY-P1338A PL-017 TFA HY-P0179A β-Casomorphin, bovine TFA
HY-P1310 VKGILS-NH2 HY-P1065 Apelin-36(rat, mouse)
HY-P1530 Prolactin Releasing Peptide (12-31), human HY-P0188 ω-Conotoxin MVIIC
HY-P1292A PKG inhibitor peptide TFA HY-P1864 β-Casomorphin (1-3), amide
HY-P1268A α-Conotoxin PIA TFA HY-P1191A JIP-1(153-163) TFA
HY-P1489A OVA Peptide(257-264) TFA HY-P1155 GRF (1-29) amide (rat)
HY-P2496 Endothelin 1 (swine, human), Alexa Fluor 488-labeled HY-P0307 Antennapedia Peptide
HY-P1239 Neuromedin S(rat) HY-P1481 β-Casomorphin, human
HY-P1846 Jagged-1 (188-204) HY-P0148 Gly6
HY-P2542 GIP (3-42), human HY-P1308A SLIGRL-NH2 TFA
HY-P2463 LKKTETQ HY-P2183A PEN(mouse) TFA
HY-P2497 Exendin (5-39) HY-P1486 Angiotensinogen (1-14), human
HY-P1869 Neuropeptide EI, rat HY-P1598 GroES mobile loop
HY-P1260 FSLLRY-NH2 HY-P1892 Competence-Stimulating Peptide-12261
HY-P1294A α-Helical CRF(9-41) TFA HY-P2361 S12
HY-P1186 Eledoisin Related Peptide HY-P0204A Endothelin-3, human, mouse, rabbit, rat TFA
HY-P1475 C-Peptide, dog HY-107663A MIF-1 TFA
HY-P1567 β-Amyloid (10-35), amide HY-P1052A Myelin Basic Protein(87-99) TFA
HY-P1573A Brain Natriuretic Peptide-45, rat TFA HY-P1242A NEP(1-40) TFA
HY-P1875 TNF-α (46-65), human HY-P0199 Pancreatic Polypeptide, human
HY-P2253 H3K27(Me2) (15-34) HY-P1377A Caffeic acid-pYEEIE TFA
HY-P0277 Carcinoembryonic Antigen CEA HY-15580 Dolastatin 10
HY-P1145 Glucagon-like peptide 1 (1-37), human HY-P1597 Malantide
HY-P1758 IFN-α Receptor Recognition Peptide 1 HY-P2457 rCRAMP (rat)
HY-P0289 CEF3 HY-P1090A Hemopressin(rat) TFA
HY-12537 Peptide 401 HY-P1754A Tetanus toxin (830-843) (TFA)
HY-P1483 Urotensin II, mouse HY-P2532 Integrin Binding Peptide
HY-P2311 Defensin HNP-2 human HY-P0279 Systemin
HY-P0329 X-press Tag Peptide HY-P0258 Mas7
HY-P2397 Fmoc-Asn(Trt)-Thr(psi(Me,Me)pro)-OH HY-P0322 GRGDSPK
HY-P1965 Ac-IEVDIDV TFA HY-P1051A β-amyloid (12-28) (TFA)
HY-P2292A Omiganan-FITC TFA HY-P0246 Mastoparan
HY-P1792A Angiotensin II (1-4), human TFA HY-P1789 CTTHWGFTLC, CYCLIC
HY-131115 Cyclo(Tyr-Leu) HY-P2386 Fmoc-Ala-Ser(psi(Me,Me)pro)-OH
HY-P2522 Competence-Stimulating Peptide-2 (CSP-2) HY-P1388A β-Amyloid (1-42), rat TFA
HY-P1568 Flagelin 22 HY-P0207A Endothelin-2 (49-69), human TFA
HY-P2454 CSP1 HY-P0328 VSV-G tag Peptide
HY-P1779A β-Casomorphin (1-5), bovine TFA HY-P1821 Myelin Basic Protein (MBP)
HY-P1231 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS HY-P1322A [D-Trp34]-Neuropeptide Y TFA
HY-P1210A Lys-γ3-MSH(human) TFA HY-P0220 PACAP (6-38), human, ovine, rat
HY-P1390A d[Cha4]-AVP TFA HY-P1847A IKKγ NBD Inhibitory Peptide TFA
HY-P1844A Chemerin-9 (149-157) (TFA) HY-P2426 (D-Trp12,Tyr34)-pTH (7-34) amide (bovine)
HY-P1574 [Arg8]-Vasotocin HY-P1662 GLGPNPCRKKCYKRDFLGR
HY-P2530 KALA HY-P1491 HIV-1 TAT 48-60
HY-P0002A Protirelin Acetate HY-P2548 pp60 (v-SRC) Autophosphorylation Site, Phosphorylated
HY-P0215A Autocamtide-2-related inhibitory peptide, myristoylated TFA HY-P1120 WKYMVM
HY-106262B Delcasertib hydrochloride HY-P0001 Thymus factor X
HY-P2502 Hepatitis Virus C NS3 Protease Inhibitor 2 HY-111659 His-Pro
HY-P1493 Fibrinopeptide B, human HY-P1291A PKI 14-22 amide,myristoylated TFA
HY-P0256 Apamin HY-P1389A Neuropeptide S (human) (TFA)
HY-P1497 Bradykinin (1-3) HY-P2402 Fmoc-Gly-Thr(psi(Me,Me)pro)-OH
HY-P1257A Xenin-8 TFA HY-P1806 Gastrin I (1-14), human
HY-P2317 Cecropin P1, porcine HY-P1921 YRGDS Fibronectin Fragment
HY-P1141A GLP-1(9-36)amide TFA HY-P0223 FLAG peptide
HY-P9970 Infliximab HY-P1289B [Ala107]MBP(104-118) TFA
HY-101399A γ-Glu-Phe TFA HY-P2455 LLO (91-99)
HY-P1521 β-Amyloid 15-21 HY-P0286 OVA Peptide 323-339
HY-P0189 ω-Conotoxin GVIA HY-P1898 β-Amyloid (13-27)
HY-P1198A Hemokinin 1, human TFA HY-100215 Biotin Hydrazide
HY-P0184 Camstatin HY-107201 β-Cyclodextrin
HY-P1591A N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys TFA HY-D1056 Lipopolysaccharides
HY-P1387 Amyloid β-peptide (1-40) rat HY-15926 ONPG
HY-P2478 Human PD-L1 inhibitor V HY-B1295 Citric acid trilithium salt tetrahydrate
HY-P1717B AMY-101 acetate HY-D0973 EGTA-AM
HY-P1171 N-terminally acetylated Endomorphin-1 HY-D0852 Sodium orthovanadate
HY-P1375A [D-Trp7,9,10]-Substance P TFA HY-D0858B MES sodium salt
HY-P1483A Urotensin II, mouse TFA HY-125859 Peroxidase
HY-P2507 NY-ESO-1 (87-111) HY-Y1841 o-Phenanthroline monohydrate
HY-P1890 CEF14, EBV Rta Protein (28-37) HY-W039911 4-Nitrophenyl α-D-galactopyranoside
HY-P0243 Luteinizing Hormone Releasing Hormone (LH-RH), salmon HY-138171 Lipid 5
HY-P1862 HSV-gB2 (498-505) HY-101885 Biotin LC hydrazide
HY-P1525A Melanin Concentrating Hormone, salmon TFA HY-107346 Enbucrilate
HY-P0154 Epsilon-V1-2 HY-Y1891 Tween 80
HY-P2242A RO27-3225 TFA HY-D0842 Bovine Serum Albumin
HY-P0293 FMRF HY-D1005 Poloxamer 407
HY-P1838 Proadrenomedullin (45-92), human HY-D0187 L-Glutathione reduced
HY-P1548 β-CGRP, human HY-B1684 Mebrofenin
HY-P1740 RGD peptide (GRGDNP) HY-B1659 Glycerol
HY-P1170 N-terminally acetylated Leu-enkephalin HY-126944 2-Aminobenzanilide
HY-P0019 Z-Gly-Gly-Arg-AMC HY-P0022 pGlu-Pro-Arg-MNA
HY-P1420 TAT-cyclo-CLLFVY HY-19804 Photo-lysine
HY-P2294 pm26TGF-β1 peptide HY-100168 BAPTA
HY-P1533 CRF, bovine HY-D0859A MOPS sodium salt
HY-P0172A ATI-2341 TFA HY-15936 γ-GT
HY-P1091 Hemopressin (human, mouse) HY-135087 Caprylic/Capric Triglyceride
HY-P1081 Acetyl-Calpastatin(184-210)(human) HY-W042416 N,N-Dimethylacetamide
HY-P0119A Lixisenatide acetate HY-15920 INT
HY-129028 H-Ala-Ala-Tyr-OH HY-D0874 HEPPSO
HY-P1226 HAEGTFTSD HY-111413 c(phg-isoDGR-(NMe)k)
HY-P1493A Fibrinopeptide B, human TFA HY-B1699 Metrizoic acid
HY-P1215 HS024 HY-18593 6-O-α-Maltosyl-β-cyclodextrin
HY-P0108 Angiotensin II 5-valine HY-23430 TES
HY-P0272 Peptide T HY-D0850 Tartaric acid disodium dihydrate
HY-P0212A Neuropeptide Y, porcine TFA HY-B1620 Polyvinylpyrrolidone
HY-P3062 [Tyr11]-Somatostatin HY-Y0921 (±)-1,2-Propanediol
HY-P1854 β-Amyloid (1-9) HY-101183 THK5351
HY-P1796A Gp100 (619-627) (acetate) HY-101103 (2-Hydroxypropyl)-β-cyclodextrin
HY-P0083 Ornipressin HY-15908 BCA
HY-P2556 Histone H3 (21-44) HY-17031 SBE-β-CD
HY-P1537 Pancreatic Polypeptide, bovine HY-D0937 Methoxy-PMS
HY-P0079 Neuromedin N HY-D0857 HEPES
HY-P1328 TAT-14 HY-D0719 Fluorescein Diacetate
HY-P2521 NS2 (114-121), Influenza HY-19695 (-)-p-Bromotetramisole oxalate
HY-P1222 LL-37, human HY-D0714 Tetrazolium Red
HY-P1868A α2β1 Integrin Ligand Peptide TFA HY-15933 TOPS
HY-P1277A GR 94800 TFA HY-15917 DTT
HY-P0298 [Des-Arg9]-Bradykinin HY-Y1888 Corn oil
HY-P1485A Substance P(1-7) TFA HY-101461 Methyl-β-cyclodextrin
HY-P2504 Syk Kinase Peptide Substrate, Biotin labeled HY-131455A Biotin-C1-PEG3-C3-amido-C5-Gly-Arg-Gly-N3 TFA
HY-P0307A Antennapedia Peptide(TFA) HY-N0186 Indole-3-butyric acid
HY-P1290A PKA Inhibitor Fragment (6-22) amide TFA HY-15929 TBHBA
HY-P1039A R18 TFA HY-15911 CNP-AFU
HY-P0228 Calcineurin substrate HY-101794 2-(Pyridyldithio)ethylamine hydrochloride
HY-P1882 Type A Allatostatin I HY-B2228 Proteinase
HY-120833 Ac-Ile-Glu-Thr-Asp-pNA HY-15906 AMPPD
HY-P1934 Cyclo(Phe-Pro) HY-D1023 5-BrdUTP sodium salt
HY-P0324A Parasin I TFA HY-P0074A GPRP acetate
HY-P2252 H3K27(Me) (15-34) HY-15913 DAOS
HY-P1418A DPC-AJ1951 TFA HY-15919 HTBA
HY-P1505A C3a (70-77) TFA HY-108299 Perfluamine
HY-P0121 ReACp53 HY-W004544 o-Phenanthroline
HY-P1948 Thioredoxin reductase peptide HY-15927 PNPG
HY-P1887 p5 Ligand for Dnak and DnaJ HY-15904 ADPS
HY-P1284A ZIP TFA HY-P0022A pGlu-Pro-Arg-MNA monoacetate
HY-P1164 Urotensin II (114-124), human HY-101400 Deoxycytidine triphosphate
HY-P2461 MOG (89-113), human HY-P0020 Tos-Gly-Pro-Arg-ANBA-IPA
HY-P1126 Dolastatin 15 HY-Y0703 Sodium carboxymethyl cellulose (Viscosity:800-1200 mPa.s)
HY-P2171A CCP peptide TFA HY-111413A c(phg-isoDGR-(NMe)k) TFA
HY-P1347 RETF-4NA HY-18569 3-Indoleacetic acid
HY-P1053 Amyloid β-Protein 10-20 HY-Y1887 COTTONSEED OIL
HY-P1340A [Ala11,D-Leu15]-Orexin B(human) TFA HY-136349 Polyoxyl 15 hydroxystearate
HY-P1106A K41498 TFA HY-125861 Methyl cellulose
HY-P2473 Neurogranin (48-76), human HY-15921 IPTG
HY-P0062 Ziconotide HY-D0875 PIPES
HY-P1756 N-Formyl-Met-Ala-Ser HY-D0855 ADA
HY-P1851A AGA-(C8R) HNG17, humanin derivative TFA HY-100894 Biotin-VAD-FMK
HY-P1263A tcY-NH2 TFA HY-15680 O-Propargyl-Puromycin
HY-P1276A Men 10376 TFA HY-Y0873 PEG300
HY-P0321 Asp-Asp-Asp-Asp-Asp HY-P0074 GPRP
HY-P0276A GIP, human TFA HY-Y1890 Cremophor EL
HY-P1017 MDL 29913 HY-Y1911 Mid-chain triglyceride of caprylic/caprolic acid
HY-P0237 KKI-5 HY-135233 N-Succinimidyl-S-acetylthioacetate
HY-P1845 PACAP-38 (31-38), human, mouse, rat HY-15918 HDAOS
HY-P1749 Influenza HA (307-319) HY-18570 1-Naphthaleneacetic acid
HY-P1559 GRGDSPC HY-Y0842 Formamide
HY-P7060 NT 13 HY-15932 TOOS
HY-P0228A Calcineurin substrate TFA HY-Y0873A PEG400
HY-P1204A [Ala17]-MCH TFA HY-D0851 Sodium molybdate
HY-P1489B OVA Peptide(257-264) acetate salt HY-15620 Methylproamine
HY-P1337 Dynorphin B (1-13) HY-107799 Castor oil
HY-P1593 Mini Gastrin I, human HY-101886 5-BrUTP sodium salt
HY-P2528 Enhanced Green Fluorescent Protein (EGFP) (200-208) HY-B1024 DL-Panthenol
HY-P1176 NTR 368 HY-15915 DTNB
HY-P1496 Leucokinin VIII HY-Y1893 Polyethylene glycol 12-hydroxystearate
HY-P0251 Neurotensin(8-13) HY-D0861 EGTA
HY-P1216A HS014 TFA HY-Y1889 Sodium carboxymethyl cellulose (Viscosity:5000-15000 mPa.s)
HY-P1590 Tyrosine Protein Kinase JAK 2 Phospho-Tyr8, 9 HY-100545 BAPTA-AM
HY-W016887 H-Gly-Pro-OH HY-D0980 Biotin-DADOO
HY-P2514 TET 830 modified/T-helper epitope from tetanus toxoid HY-D0975 Sulfo-SMCC sodium
HY-P1377 Caffeic acid-pYEEIE HY-129832 Biotin-azide
HY-P1582 ACTH (1-14) HY-Y1892 Gelucire 44/14
HY-P2333 LCKLSL HY-D1021 AA-dUTP sodium salt
HY-P2256 H3K4(Me2) (1-20) HY-D0858 MES
HY-P1010 Z-LEHD-FMK HY-15916 DTE
HY-P0035 Insulin (human) HY-D0183 ATP-polyamine-biotin
HY-P1482 α-Factor Mating Pheromone, yeast HY-B1102 Evans Blue
HY-P1180A Pam3CSK4 TFA HY-D0837 Imidazole
HY-P0252 α-Melanocyte-Stimulating Hormone (MSH), amide HY-P9912 Pertuzumab
HY-P1841 Glucagon-Like Peptide (GLP) II, human HY-P9910 Obinutuzumab
HY-P1411 Psalmotoxin 1 HY-P9970 Infliximab
HY-P1586 HIV-1 Rev 34-50 HY-P9802 Anti-Spike-RBD Single Domain mAb
HY-P7061A ALX 40-4C Trifluoroacetate HY-P9911 Vedolizumab
HY-P1317 Nociceptin (1-13), amide HY-108847 Etanercept
HY-P2295 Dabcyl-KTSAVLQSGFRKME-Edans TFA HY-P9904 Atezolizumab
HY-P1203A BIM-23056 TFA HY-P9926 Dupilumab
HY-P1164A Urotensin II (114-124), human TFA HY-P9905 Cetuximab
HY-P1876 NLS (PKKKRKV) HY-P9903 Nivolumab
HY-P1305 CART(55-102)(rat) HY-P9804 Anti-MERS-2E6 mAb
HY-P1143 [Des-His1,Glu9]-Glucagon amide HY-P9920 Ramucirumab
HY-P0297 Protease-Activated Receptor-4 HY-P9919 Durvalumab
HY-P1031 [bAla8]-Neurokinin A(4-10) HY-P9803 Anti-SARS-80R mAb
HY-P1536 Thrombin Receptor Activator for Peptide 5 TRAP-5 HY-P9907 Trastuzumab
HY-P1264 α-Bungarotoxin HY-P9908 Adalimumab
HY-P1297 CRF(6-33)(human) HY-P9913 Rituximab
HY-P0253A Xenopsin TFA HY-108831 Natalizumab
HY-P1073 ProTx-I HY-P9921 Trastuzumab emtansine
HY-P0015 Somatostatin HY-P9902 Pembrolizumab
HY-P2255 H3K4(Me) (1-20) HY-108730 Avelumab
HY-P1241 BAM(8-22) HY-P9923 Benralizumab
HY-P0177 123C4 HY-P9806 Anti-MERS-D12 mAb
HY-P2562 β-Amyloid (1-38), mouse, rat HY-P9901 Ipilimumab
HY-P1471 Adrenomedullin (AM) (22-52), human HY-P9805 Anti-MERS-3A1 mAb
HY-P1122 Cyclosporin H HY-P9909 Ustekinumab
HY-P2341 Angiopep-2 hydrochloride HY-P9801 Anti-Spike-RBD mAb
HY-P1863 α-Neoendorphin (1-8) HY-108829 Abatacept
HY-P1906 [pThr3]-CDK5 Substrate HY-P9949 Reslizumab
HY-P1470 [Leu5]-Enkephalin, amide HY-P9906 Bevacizumab
HY-P1401 Protein Kinase C (19-36) HY-P9917 Tocilizumab
HY-P2517 Scrambled TRAP Fragment HY-108841 Anakinra
HY-P1157 Exendin derivative 1 HY-P9807 Anti-SARS-CoV-2 Spike mAb (CR3022)
HY-P1485 Substance P(1-7) HY-P7014 Recombinant Human Fibroblast Growth Factor 4
HY-P0091 Thymalfasin HY-P7015 Recombinant Human Granulocyte Colony Stimulating Factor
HY-136542 H-β-Ala-AMC TFA HY-P7015A Recombinant Human Granulocyte Colony Stimulating Factor (CHO-expressed)
HY-P1338 PL-017 HY-P7026 Recombinant Human Interferon-lambda1/Interleukin-29
HY-P1354 Cyclosporin A-Derivative 2 HY-P7027 Recombinant Human Interleukin-1 alpha
HY-P0269 Magainin 1 HY-P7028 Recombinant Human Interleukin-1 beta
HY-P0224 N-Formyl-Met-Leu-Phe HY-P7030A Recombinant Human Interleukin-10 (CHO-expressed)
HY-P0052A Enfuvirtide acetate HY-P7031 Recombinant Human Interleukin-11
HY-P1452A RNAIII-inhibiting peptide(TFA) HY-P7031A Recombinant Human Interleukin-11 (CHO-expressed)
HY-P1098 Ac2-26 HY-P7040 Recombinant Human Interleukin-3
HY-P1591 N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys HY-P7040A Recombinant Human Interleukin-3 (CHO-expressed)
HY-P1214 γ1-MSH HY-P7041 Recombinant Human Interleukin-33
HY-P2506A Gp100 (25-33), mouse TFA HY-P7050A Recombinant Human Macrophage Colony-stimulating Factor (CHO-expressed)
HY-P2257 H3K4(Me3) (1-20) HY-P7051A Recombinant Human Noggin (CHO-expressed)
HY-P1834 MARCKS Peptide(151-175), Phosphorylated HY-P7052 Recombinant Human Oncostatin-M, 227a.a.
HY-P1468 β-Amyloid (1-28) HY-P7052A Recombinant Human Oncostatin-M, 209a.a.
HY-P0269A Magainin 1 TFA HY-P7053 Recombinant Human Osteoprotegerin
HY-P1286 PKC β pseudosubstrate HY-P7029 Recombinant Human Interleukin-1 Receptor Antagonist Protein
HY-P1796 Gp100 (619-627) HY-P7029A Recombinant Human Interleukin-1 Receptor Antagonist Protein (HEK293-expressed)
HY-P2501 Amylin (8-37), human HY-P7030 Recombinant Human Interleukin-10
HY-P1419 AP 811 HY-P7063 Recombinant Mouse Interleukin-6
HY-P0119 Lixisenatide HY-P7064 Recombinant Mouse Stem Cell Factor (P.pastoris-expressed)
HY-P1012A [Sar9,Met(O2)11]-Substance P TFA HY-P7017 Recombinant Human Heparin-binding EGF-like Growth Factor
HY-P1547 Somatostatin-25 HY-P7018 Recombinant Human Insulin-like Growth Factor-1
HY-P2360 G12 HY-P7019 Recombinant Human Insulin-like Growth factor-2
HY-P1759 N-CBZ-Phe-Arg-AMC HY-P7007 Recombinant Human Bone Morphogenetic Protein 4
HY-P0022 pGlu-Pro-Arg-MNA HY-P7008 Recombinant Human Bone Morphogenetic Protein 7
HY-P1298A Sauvagine TFA HY-P7009 Recombinant Human Endostatin (P.pastoris-expressed)
HY-P1224 HAEGTFTSDVS HY-P7010 Recombinant Human Epigen
HY-P0325 V5 Epitope Tag Peptide Trifluoroacetate HY-P7035 Recombinant Human Interleukin-16, 130a.a.
HY-P0176 PACAP (1-27), human, ovine, rat HY-P7036 Recombinant Human Interleukin-17
HY-P1077A CALP1 TFA HY-P7037 Recombinant Human Interleukin-2
HY-P0245 Speract HY-P7037A Recombinant Human Interleukin-2 (CHO-expressed)
HY-P1932 Cortistatin-14 HY-P7044 Recombinant Human Interleukin-6
HY-P2560 LCMV GP (61-80) HY-P7044A Recombinant Human Interleukin-6 (CHO-expressed)
HY-P2313 Human β-defensin-2 HY-P7045 Recombinant Human Interleukin-7
HY-P2511 Insulin β Chain Peptide (15-23) HY-P7054 Recombinant Human Pigment Epithelium-derived Factor
HY-101399 γ-Glu-Phe HY-P7055 Recombinant Human Platelet-derived Growth Factor-BB
HY-P1308 SLIGRL-NH2 HY-P7055A Recombinant Human Platelet-derived Growth Factor-BB (P.pastoris-expressed)
HY-P2470 Human PD-L1 inhibitor II HY-P7065 Recombinant Mouse Acidic Fibroblast Growth Factor
HY-P1304 CART(55-102)(human) HY-P7066 Recombinant Mouse Basic Fibroblast Growth Factor
HY-P1824 C-Reactive Protein (CRP) (201-206) HY-P7067 Recombinant Mouse Epidermal Growth Factor
HY-P1160 Bay 55-9837 HY-P7104 Recombinant Rat Interleukin-7, His (CHO-expressed)
HY-P1556 Vasonatrin Peptide VNP HY-P7068 Recombinant Mouse Granulocyte Colony-stimulating Factor (CHO-expressed)
HY-P1832A PTD-p65-P1 Peptide TFA HY-P7069 Recombinant Mouse Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed)
HY-P2289 pBD-1 HY-P7070 Recombinant Mouse Insulin-like Growth factor-1
HY-P1542 Urotensin I HY-P7083 Recombinant Mouse Interleukin-9 (CHO-expressed)
HY-P1462A Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA HY-P7084 Recombinant Mouse Leukemia Inhibitory Factor
HY-P1216 HS014 HY-P7087 Recombinant Mouse Platelet-derived Growth Factor-BB
HY-P2524 MAGE-3 (271-279) HY-P7088 Recombinant Mouse Thrombopoietin (CHO-expressed)
HY-P1477 Adrenocorticotropic Hormone (ACTH) (1-39), rat HY-P7090 Recombinant Mouse Tumor Necrosis Factor-alpha/TNFSF2
HY-P1121A WKYMVM-NH2 TFA HY-P7090A Recombinant Mouse Tumor Necrosis Factor-alpha/TNFSF2 (P.pastoris-expressed)
HY-P0086A Corticotropin-releasing factor (human) (acetate) HY-P7075A Recombinant Mouse Interleukin-11 (HEK293-expressed)
HY-P2396 Fmoc-Ile-Thr(psi(Me,Me)pro)-OH HY-P7077 Recombinant Mouse Interleukin-2
HY-P2479 Peripheral Myelin Protein P2 (53-78), bovine HY-P7078 Recombinant Mouse Interleukin-21
HY-P3124 BIM-23190 HY-P7079 Recombinant Mouse Interleukin-22
HY-P2531 OVA (329-337) HY-P7020 Recombinant Human Insulin-like Growth Factor-Binding Protein 3
HY-P1471A Adrenomedullin (AM) (22-52), human TFA HY-P7021 Recombinant Human Insulin-like Growth Factor-Binding Protein 5
HY-P2509 Histone H2A (1-20) HY-P7022 Recombinant Human Interferon-alpha2a
HY-P2480 Histone H1-derived Peptide HY-P7085 Recombinant Mouse Macrophage Colony Stimulating Factor
HY-118090A D-γ-Glutamyl-D-glutamic acid HY-P7085A Recombinant Mouse Macrophage Colony Stimulating Factor (CHO-expressed)
HY-P1848 Pep-1 (uncapped) HY-P7086 Recombinant Mouse Noggin (CHO-expressed)
HY-P1558 ACTH (11-24) HY-P7038 Recombinant Human Interleukin-21
HY-P1244A Secretin (33-59), rat TFA HY-P7039 Recombinant Human Interleukin-22
HY-P1189 Echistatin HY-P7039A Recombinant Human Interleukin-22 (HEK293-expressed)
HY-P1382 Rac1 Inhibitor W56 HY-P7046 Recombinant Human Interleukin-9 (CHO-expressed)
HY-P1175A L-R4W2 TFA HY-P7047 Recombinant Human Keratinocyte Growth Factor 1/FGF-7
HY-P0254 Kisspeptin-10, human HY-P7047A Recombinant Human Keratinocyte Growth Factor 1/FGF-7 (CHO-expressed)
HY-P1836 C-Reactive Protein (CRP) (77-82) HY-P7056 Recombinant Human Stem Cell Factor (P.pastoris-expressed)
HY-P1855 HER2/neu (654-662) GP2 HY-P7057 Recombinant Human Thymic Stromal Lymphopoietin
HY-P2388 Fmoc-Lys(Boc)-Thr(psi(Me,Me)pro)-OH HY-P7032 Recombinant Human Interleukin-12 (HEK293-expressed)
HY-P2258 Histone H3 (1-34) HY-P7033 Recombinant Human Interleukin-13 (CHO-expressed)
HY-P0139 Gap 27 HY-P7034 Recombinant Human Interleukin-15
HY-P1268 α-Conotoxin PIA HY-P7071 Recombinant Mouse Interferon-gamma
HY-P1850 β-Amyloid (1-20) HY-P7072 Recombinant Mouse Interleukin-1 alpha
HY-P1798 Platelet Factor 4 (58-70), human HY-P7073 Recombinant Mouse Interleukin-1 beta
HY-P0287 QL9 HY-P7091 Recombinant Rat Basic Fibroblast Growth Factor
HY-P2409 Fmoc-Phe-Thr(psi(Me,Me)pro)-OH HY-P7092 Recombinant Rat Epidermal Growth Factor
HY-P2249 ELA-21 (human) HY-P7092A Recombinant Rat Epidermal Growth Factor (CHO-expressed)
HY-P1252A Parathyroid Hormone (1-34), bovine TFA HY-P7095 Recombinant Rat Interferon-gamma
HY-P1209 PG106 HY-P7095A Recombinant Rat Interferon-gamma (CHO-expressed)
HY-P1587A IRBP (1-20), human TFA HY-P7096 Recombinant Rat Interleukin-1 alpha (CHO-expressed)
HY-P1050A COG 133 TFA HY-P7097 Recombinant Rat Interleukin-1 beta
HY-P2274 Argifin HY-P7097A Recombinant Rat Interleukin-1 beta (HEK293-expressed)
HY-P2285 AC 253 HY-P7098 Recombinant Rat Interleukin-10
HY-P1539 Cecropin A HY-P7098A Recombinant Rat Interleukin-10 (CHO-expressed)
HY-P1071A α-CGRP(human) TFA HY-P7100 Recombinant Rat Interleukin-2 (CHO-expressed)
HY-P1731 Tirzepatide HY-P7102 Recombinant Rat Interleukin-5
HY-P1342 Prosaptide Tx14(A) HY-P7102A Recombinant Rat Interleukin-5 (CHO-expressed)
HY-P3057 [D-Trp11]-Neurotensin HY-P7103A Recombinant Rat Interleukin-6 (HEK293-expressed)
HY-P1741 Fibrinogen-Binding Peptide HY-P7105 Recombinant Rat Oncostatin-M
HY-P0306 Fibronectin Adhesion-promoting Peptide HY-P7107 Recombinant Rat Stem Cell Factor (P.pastoris-expressed)
HY-P2230 Angstrom6 HY-P7107A Recombinant Rat Stem Cell Factor (HEK293-expressed)
HY-P2412 Fmoc-Trp(Boc)-Ser(psi(Me,Me)pro)-OH HY-P7108 Recombinant Rat Tumor Necrosis Factor-alpha/TNFSF2 (P.pastoris-expressed)
HY-P0129 PLP 139-151 HY-P7109 Recombinant Human Epidermal Growth Factor
HY-P2458 CAP18 (rabbit) HY-P7110 Recombinant Human Vascular Endothelial Growth Factor 165 (P.pastoris-expressed)
HY-B2196 Gastric mucin HY-P7110A Recombinant Human Vascular Endothelial Growth Factor 165 (HEK293-expressed)
HY-P1816 Fibronectin CS1 Peptide HY-P7111 Recombinant Human Fms-related Tyrosine Kinase 3 Ligand (CHO-expressed)
HY-P1576A AMARA peptide TFA HY-P7112 Recombinant Human Parathyroid Hormone, 1-84a.a.
HY-P2462 Ac-Arg-Gly-Lys(Ac)-AMC HY-P7113 Recombinant Human 4-1BB Ligand/TNFSF9
HY-P1323 [Leu31,Pro34]-Neuropeptide Y(human,rat) HY-P7114 Recombinant Human R-spondin-1/RSPO1
HY-P2360A G12 TFA HY-P7117 Recombinant Mouse TGF-beta 1/TGFB1 (HEK293-expressed)
HY-P1789A CTTHWGFTLC, CYCLIC TFA HY-P7093 Recombinant Rat Granulocyte Colony-Stimulating Factor
HY-P2539 Big Endothelin-1 (1-39), porcine HY-P7093A Recombinant Rat Granulocyte Colony-Stimulating Factor (HEK293-expressed)
HY-P1132A Galanin (1-29)(rat, mouse) TFA HY-P7094 Recombinant Rat Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed)
HY-P0221A PACAP (1-38), human, ovine, rat TFA HY-P7023 Recombinant Human Interferon-alpha2b
HY-P2519 Protease-Activated Receptor-3 (PAR-3) (1-6), human HY-P7024 Recombinant Human Interferon-beta (HEK293-expressed)
HY-P1341 OXA(17-33) HY-P7025 Recombinant Human Interferon-gamma
HY-P1201A Cyclosomatostatin TFA HY-P7025A Recombinant Human Interferon-gamma (CHO-expressed)
HY-131110 Cyclo(Ala-Glu) HY-P7010A Recombinant Human Epigen (CHO-expressed)
HY-P1296 Urocortin, rat HY-P7011 Recombinant Human Epiregulin
HY-P0053 Fertirelin HY-P7012 Recombinant Human Fibroblast Growth Factor 21
HY-P2632A RAD16-I hydrochloride HY-P7013 Recombinant Human Fibroblast Growth Factor 23
HY-P1316 Ac-RYYRWK-NH2 HY-P7001 Recombinant Human Acidic Fibroblast Growth Factor
HY-P3129 KRAS G13D peptide, 25 mer HY-P7002 Recombinant Human Amphiregulin (HEK293-expressed)
HY-P2535 Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human HY-P7003 Recombinant Human B cell Activating Factor/TNFSF13B (CHO-expressed)
HY-P1674A Murepavadin TFA HY-P7048 Recombinant Human Keratinocyte Growth Factor-2/FGF-10
HY-P1867 β-Amyloid (1-34) HY-P7049 Recombinant Human Leukemia Inhibitory Factor
HY-P1878 Proinsulin C-Peptide (55-89), human HY-P7050 Recombinant Human Macrophage Colony-stimulating Factor
HY-P0294 Hexa-His HY-P7042 Recombinant Human Interleukin-4 (CHO-expressed)
HY-P1548B β-CGRP, human acetate HY-P7043 Recombinant Human Interleukin-5
HY-P2471 Neurogranin (48-76), mouse HY-P7043A Recombinant Human Interleukin-5 (CHO-expressed)
HY-131111 Cyclo(Gly-Gln) HY-P7016 Recombinant Human Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed)
HY-P1817 PACAP-38 (16-38), human, mouse, rat HY-P7016A Recombinant Human Granulocyte-Macrophage Colony Stimulating Factor
HY-P1045 187-1, N-WASP inhibitor HY-P7016B Recombinant Human Granulocyte-Macrophage Colony Stimulating Factor (P.pastoris-expressed)
HY-P3138 (Sar1)-Angiotensin II HY-P7058 Recombinant Human Tumor Necrosis Factor-alpha/TNFSF2
HY-P1735 Moth Cytochrome C (MCC) (88-103) HY-P7058A Recombinant Human Tumor Necrosis Factor-alpha/TNFSF2 (P.pastoris-expressed)
HY-P0185 Endomorphin 1 HY-P7062 Recombinant Mouse Interleukin-3, 135a.a.
HY-P2525 GAD65 (206-220) HY-P7004 Recombinant Human Basic Fibroblast Growth Factor
HY-P0054 GLP-1(7-36), amide acetate HY-P7005 Recombinant Human Betacellulin
HY-P0188A ω-Conotoxin MVIIC TFA HY-P7006 Recombinant Human Bone Morphogenetic Protein 2
HY-126810A NP213 TFA HY-P7073A Recombinant Mouse Interleukin-1 beta (CHO-expressed)
HY-P2506 Gp100 (25-33), mouse HY-P7074A Recombinant Mouse Interleukin-10 (CHO-expressed)
HY-P1063A LF11 TFA HY-P7080 Recombinant Mouse Interleukin-4 (CHO-expressed)
HY-P0097A Nonapeptide-1 acetate salt HY-P7081 Recombinant Mouse Interleukin-5
HY-108742A Abaloparatide TFA HY-P7081A Recombinant Mouse Interleukin-5 (CHO-expressed)
HY-112173 Prolylleucine HY-P7082 Recombinant Mouse Interleukin-7 (CHO-expressed)
HY-P2499 BAD (103-127) (human), FAM-labeled HY-P7118 Recombinant Human Transforming Growth Factor β1
HY-P1282 Agitoxin-2 HY-P7119 Recombinant Human Transforming Growth Factor β2
HY-P1809 c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2 HY-P7120 Recombinant Human Transforming Growth Factor beta3 (HEK293-expressed)
HY-P1302A Orphanin FQ(1-11) TFA HY-P7121 Recombinant Human Hepatocyte Growth Factor (CHO-expressed)
HY-P2319A OVA-E1 peptide TFA HY-P7123 Recombinant Human Fibroblast Growth Factor 18
HY-13948 Angiotensin II human HY-P7124 Recombinant Rat Fibroblast Growth Factor 18
HY-P1732 Transportan HY-P7116A Recombinant Human BDNF/Brain-derived neurotrophic factor
HY-P2342 Angiopep-Bim BH3 hydrochloride HY-P7076A Recombinant Mouse Interleukin-13, His (CHO-expressed)
HY-P1365 α-Conotoxin MII HY-P7125 Recombinant Human 4-1BBR/TNFRSF9
HY-P1194A Spantide I TFA HY-P7126 Recombinant Human Adiponectin (CHO-expressed)
HY-P1127 Galanin (1-30), human HY-P7127 Recombinant Human Adiponectin (HEK293-expressed)
HY-P0238 Gastrin-Releasing Peptide, human HY-P7128 Recombinant Human Adiponectin
HY-P1184 HNGF6A HY-P7129 Recombinant Mouse Adiponectin
HY-P1060A LPYFD-NH2 TFA HY-P7130 Recombinant Human BAFF Receptor
HY-P1915 26Rfa, Hypothalamic Peptide, human HY-P7131 Recombinant Human BCA-1/CXCL13
HY-P1505 C3a 70-77 HY-P7132 Recombinant Human BCMA
HY-P0291 Kemptide Phospho-Ser5 HY-P7133 Recombinant Human Beta Defensin-1
HY-P0265A β-Amyloid (1-40) (TFA) HY-P7134 Recombinant Rat Beta Defensin-1
HY-P1856 Proinsulin C-peptide (human) HY-P7135 Recombinant Human beta Defensin-2
HY-P1795 N-Boc-Phe-Leu-Phe-Leu-Phe HY-P7136 Recombinant Mouse Beta Defensin-2
HY-P0281A TAT TFA HY-P7137 Recombinant Human Beta Defensin-3
HY-P1569 LCMV gp33-41 HY-P7138 Recombinant Mouse Beta Defensin-3
HY-P1230 HAEGT HY-P7139 Recombinant Rat Beta Defensin-3
HY-P1504 β-Melanocyte Stimulating Hormone (MSH), human HY-P7140 Recombinant Human Beta Defensin-4
HY-P0326 S Tag Peptide HY-P7141 Recombinant Rat Beta Defensin-4
HY-P1022A Kisspeptin-54(human) TFA HY-P7142 Recombinant Mouse Betacellulin (HEK293-expressed)
HY-P0073 Tyr-Gly-Gly-Phe-Met-OH HY-P7143 Recombinant Mouse CCL6
HY-P2493 (Cys47)-HIV-1 tat Protein (47-57) HY-P7144 Recombinant Human CD40 Ligand
HY-P0271 Syntide 2 HY-P7145 Recombinant Human Ciliary Neurotrophic Factor (HEK293-expressed)
HY-P1342A Prosaptide Tx14(A) TFA HY-P7146 Recombinant Human Ciliary Neurotrophic Factor
HY-P1260A FSLLRY-NH2 TFA HY-P7147 Recombinant Mouse CNTF
HY-P1320A [Nphe1]Nociceptin(1-13)NH2 TFA HY-P7148 Recombinant Rat Ciliary Neurotrophic Factor
HY-P2244A YAP-TEAD-IN-1 TFA HY-P7149 Recombinant Human Cardiotrophin-1 (CHO-expressed)
HY-P2561 Influenza Matrix Protein (61-72) HY-P7150 Recombinant Mouse Cardiotrophin-1 (HEK293-expressed)
HY-P1464 Amylin, amide, rat HY-P7151 Recombinant Mouse CXCL16
HY-N6689 Destruxin A HY-P7152 Recombinant Rat CXCL3 (CHO-expressed)
HY-P0283 Protease-Activated Receptor-2, amide HY-P7153 Recombinant Mouse CXCL3
HY-P1944 Apelin-13 HY-P7154 Recombinant Mouse DKK-1 (CHO-expressed)
HY-P1561 PKG Substrate HY-P7156 Recombinant Human EMAP-II
HY-P1488 Bradykinin (1-5) HY-P7157 Recombinant Human Epithelial Neutrophil Activating Peptide-78/CXCL5 (HEK293-expressed)
HY-106224 Orexin A (human, rat, mouse) HY-P7158 Recombinant Human Epithelial Neutrophil Activating Peptide-78/CXCL5
HY-P2108 Lysobactin HY-P7159 Recombinant Human Eotaxin/CCL11
HY-P1835 CEF8, Influenza Virus NP (383-391) HY-P7160 Recombinant Mouse Eotaxin/CCL11
HY-P3101 GLP-1(28-36)amide HY-P7161 Recombinant Human Eotaxin-2/CCL24
HY-P1304A CART(55-102)(human) TFA HY-P7162 Recombinant Rat Eotaxin-2/CCL24
HY-P1022 Kisspeptin-54(human) HY-P7163 Recombinant Human Eotaxin-3/CCL26
HY-P2477 Human PD-L1 inhibitor IV HY-P7164 Recombinant Human Erythropoietin (CHO-expressed)
HY-P0261 Indolicidin HY-P7166 Recombinant Human Exodus-2/CCL21
HY-P0198A Neuropeptide Y (29-64), amide, human TFA HY-P7167 Recombinant Mouse Exodus-2/CCL21
HY-P1015A VIP(Guinea pig) TFA HY-P7168 Recombinant Human FASR/TNFRSF6 (HEK293-expressed)
HY-P1200A Ac-Tyr(PO3H2)-Glu-Glu-Ile-Glu-OH TFA HY-P7169 Recombinant Human FASR/TNFRSF6
HY-P1301 [Arg14,Lys15]Nociceptin HY-P7170 Recombinant Mouse Fibroblast Growth Factor-10
HY-P1278A GR 64349 TFA HY-P7171 Recombinant Mouse Fibroblast Growth Factor-18
HY-P0222 PKI(5-24) HY-P7172 Recombinant Human Fibroblast Growth Factor-19
HY-P1763 Urechistachykinin II HY-P7173 Recombinant Mouse Fibroblast Growth Factor-21
HY-P1812A AUNP-12 TFA HY-P7174 Recombinant Human Fibroblast Growth Factor-6
HY-P1247A Calcineurin autoinhibitory peptide TFA HY-P7176 Recombinant Mouse Fibroblast Growth Factor-7
HY-P2262A TAT-DEF-Elk-1 TFA HY-P7177 Recombinant Human Fibroblast Growth Factor-9
HY-P0225 Autocamtide 2 HY-P7178 Recombinant Rat Fibroblast Growth Factor-9
HY-P2541 GIP (1-30) amide, porcine HY-P7179 Recombinant Bovine Basic Fibroblast Growth Factor
HY-P2411 Fmoc-Gln(Trt)-Thr(psi(Me,Me)pro)-OH HY-P7180 Recombinant Human Fractalkine/CX3CL1
HY-P1026 NFAT Inhibitor HY-P7181 Recombinant Human Granulocyte Chemotactic Protein-2/CXCL6 (CHO-expressed)
HY-103048A PD-1/PD-L1-IN 3 TFA HY-P7182 Recombinant Human Glial Cell Line-derived Neurotrophic Factor
HY-P0207 Endothelin-2 (49-69), human HY-P7183 Recombinant Human Growth Hormone
HY-P0148A Gly6 hydrochloride HY-P7184 Recombinant Rhesus Macaque Granulocyte Macrophage Colony Stimulating Factor
HY-P1777A IGF-I (24-41) (TFA) HY-P7185 Recombinant Mouse Granzyme B (CHO-expressed)
HY-P0222A PKI(5-24) TFA HY-P7186 Recombinant Mouse GRO alpha/CXCL1 (CHO-expressed)
HY-P0221 PACAP (1-38), human, ovine, rat HY-P7187 Recombinant Human GRO alpha/CXCL1
HY-P1492 Substance P (7-11) HY-P7188 Recombinant Mouse GRO alpha/CXCL1
HY-P1145A Glucagon-like peptide 1 (1-37), human TFA HY-P7189 Recombinant Rat GRO alpha/CXCL1
HY-P0086 Corticotropin-releasing factor (human) HY-P7190 Recombinant Human GRO beta/CXCL2
HY-P2563 [Tyr(P)4] Angiotensin II HY-P7191 Recombinant Rat GRO beta/CXCL2
HY-P1070 Amylin, amide, human HY-P7192 Recombinant Human GRO gama/CXCL3 (CHO-expressed)
HY-100563A Cyclo(RGDyK) HY-P7193 Recombinant Human GRO gama/CXCL3
HY-P2559 CDK7/9 tide HY-P7194 Recombinant Mouse Heparin-Binding EGF-like Growth Factor
HY-P1064A Apelin-36(human) TFA HY-P7195 Recombinant Human Hemofiltrate CC Chemokine-1/CCL14
HY-P1373 Neuronostatin-13 human HY-P7196 Recombinant Human Hemofiltrate CC Chemokine-4/CCL16 (CHO-expressed)
HY-P0206 Bradykinin HY-P7197 Recombinant Human Hemofiltrate CC Chemokine-4/CCL16
HY-P2329 Lysostaphin HY-P7198 Recombinant Human I-309/CCL1 (CHO-expressed)
HY-P1235 Carperitide HY-P7199 Recombinant Human I-309/CCL1
HY-P1563 Osteogenic Growth Peptide, OGP HY-P7201 Recombinant Human Interferon Omega
HY-P2324 Gramicidin A HY-P7203 Recombinant Rat Insulin-like Growth Factor-I
HY-P1736 Influenza HA (126-138) HY-P7204 Recombinant Human Indian hedgehog protein
HY-P1513A LL-37 scrambled peptide acetate HY-P7205 Recombinant Human Interleukin-1 beta (CHO-expressed)
HY-P1014 HCGRP-(8-37) HY-P7206 Recombinant Porcine Interleukin-1 beta
HY-P1519B Brain Natriuretic Peptide (1-32), rat acetate HY-P7207 Recombinant Rhesus Macaque Interleukin-1 beta
HY-P0076A TAK-448 acetate HY-P7208 Recombinant Mouse Interleukin-12 (CHO-expressed)
HY-P0318 Hemorphin-7 HY-P7209 Recombinant Human Interleukin-17F
HY-P1348 GLP-1 moiety from Dulaglutide HY-P7210 Recombinant Rat Interleukin-18
HY-P1839 Angiotensin I/II (1-5) HY-P7211 Recombinant Human Interleukin-18 Binding Protein (CHO-expressed)
HY-P1290 PKA Inhibitor Fragment (6-22) amide HY-P7212 Recombinant Human Interleukin-19
HY-P2247 JTP10-△-R9 TFA HY-P7213 Recombinant Mouse Interleukin-19
HY-P1016A BQ-3020 TFA HY-P7214 Recombinant Human Interleukin-20
HY-P1779 β-Casomorphin (1-5), bovine HY-P7215 Recombinant Human Interleukin-2 Receptor alpha, His (HEK293-expressed)
HY-P0231 AZP-531 HY-P7216 Recombinant Canine Interleukin-3
HY-P0150 Glucagon (19-29), human HY-P7217 Recombinant Human Interleukin-31
HY-P1894 β-Amyloid Protein Precursor 770 (135-155) HY-P7218 Recombinant Mouse Interleukin-33
HY-P1312 LRGILS-NH2 HY-P7219 Recombinant Porcine Interleukin-4 (CHO-expressed)
HY-P1060 LPYFD-NH2 HY-P7220 Recombinant Human Interleukin-4 Receptor (HEK293-expressed)
HY-P1036 Compstatin HY-P7221 Recombinant Human Interleukin-5 Receptor alpha (CHO-expressed)
HY-P0263A Dermaseptin TFA HY-P7222 Recombinant Rhesus Macaque Interleukin-6
HY-P2541A GIP (1-30) amide, porcine TFA HY-P7223 Recombinant Human Interleukin-6 Receptor (CHO-expressed)
HY-P1455A Adrenomedullin (AM) (1-52), human TFA HY-P7224 Recombinant Human Interleukin-8/CXCL8
HY-P1257 Xenin-8 HY-P7225 Recombinant Rat IP-10/CRG-2/CXCL10 (HEK293-expressed)
HY-P1826A CLIP (86-100) (TFA) HY-P7226 Recombinant Human IP-10/CXCL10
HY-P1504A β-Melanocyte Stimulating Hormone (MSH), human TFA HY-P7227 Recombinant Mouse IP-10/CXCL10
HY-P9920 Ramucirumab HY-P7228 Recombinant Human I-TAC/CXCL11 (HEK293-expressed)
HY-P2551 Biotin-β-Amyloid (17-40) HY-P7229 Recombinant Human I-TAC/CXCL11
HY-P3139A TPP-1 TFA HY-P7230 Recombinant Mouse KGF/FGF-7
HY-P1506 [Nle11]-Substance P HY-P7231 Recombinant Human LD78 beta/CCL3L1
HY-P1046 β-Amyloid 1-15 HY-P7232 Recombinant Human Leptin
HY-P1574A [Arg8]-Vasotocin TFA HY-P7233 Recombinant Rat Leptin
HY-P1061A Colivelin TFA HY-P7234 Recombinant Human Lymphotactin/XCL1
HY-P2228 Chlamydocin HY-P7235 Recombinant Mouse MCP-1/CCL2 (HEK293-expressed)
HY-P2399 Fmoc-Glu(OtBu)-Thr(psi(Me,Me)pro)-OH HY-P7236 Recombinant Rat MCP-1/CCL2 (HEK293-expressed)
HY-P1236A Atrial Natriuretic Peptide (ANP) (1-28), rat TFA HY-P7237 Recombinant Human Monocyte Chemotactic Protein-1/CCL2
HY-P1780 CEF20 HY-P7238 Recombinant Human Monocyte Chemotactic Protein-2/CCL8
HY-P1112A Sarafotoxin S6a TFA HY-P7239 Recombinant Mouse MCP-2/CCL8
HY-114161 H-Val-Pro-Pro-OH HY-P7240 Recombinant Human Monocyte Chemotactic Protein-3/CCL7 (CHO-expressed)
HY-P1808 LGnRH-III, lamprey HY-P7241 Recombinant Mouse MCP-3/CCL7 (CHO-expressed)
HY-P1334A DPDPE TFA HY-P7242 Recombinant Human Monocyte Chemotactic Protein-3/CCL7
HY-P1785 Abl Cytosolic Substrate HY-P7243 Recombinant Mouse MCP-3/CCL7
HY-P2344 HIV Protease Substrate 1 HY-P7244 Recombinant Rat MCP-3/CCL7
HY-41189 Fmoc-Val-Cit-PAB-PNP HY-P7245 Recombinant Human Monocyte Chemotactic Protein-4/CCL13
HY-P1187A HSDVHK-NH2 TFA HY-P7246 Recombinant Mouse MCP-5/CCL12 (CHO-expressed)
HY-P0178A LXW7 TFA HY-P7247 Recombinant Rat Macrophage-Colony Stimulating Factor (CHO-expressed)
HY-P1762A Influenza NP (147-155) (TFA) HY-P7248 Recombinant Mouse MDC/CCL22
HY-P1837 Influenza HA (518-526) HY-P7249 Recombinant Rat MDC/CCL22
HY-P2193 TAT-amide HY-P7250 Recombinant Human MEC/CCL28
HY-U00372 2: PN: US20040072744 SEQID: 2 claimed protein HY-P7251 Recombinant Mouse MEC/CCL28
HY-P1175 L-R4W2 HY-P7252 Recombinant Rat MEC/CCL28
HY-P1331 BAM-22P HY-P7253 Recombinant Human MIG/CXCL9
HY-P1900 SEB Domain (144-153) HY-P7254 Recombinant Human MIP-1 alpha/CCL3 (CHO-expressed)
HY-P0122 iRGD peptide HY-P7255 Recombinant Mouse Macrophage Inflammatory Protein-1 alpha/CCL3 (HEK293-expressed)
HY-P1209A PG106 TFA HY-P7256 Recombinant Human MIP-1 alpha/CCL3
HY-P1090 Hemopressin(rat) HY-P7257 Recombinant Human MIP-1 beta/CCL4
HY-P2395 Fmoc-Tyr(tBu)-Thr(psi(Me,Me)pro)-OH HY-P7258 Recombinant Mouse Macrophage Inflammatory Protein-2/CXCL2
HY-P1900A SEB Domain (144-153) (TFA) HY-P7259 Recombinant Human MIP-3/CCL23 (CHO-expressed)
HY-P1344 DAPK Substrate Peptide HY-P7260 Recombinant Human MIP-3 alpha/CCL20 (CHO-expressed)
HY-P1311A RLLFT-NH2 TFA HY-P7261 Recombinant Rat Macrophage Inflammatory Protein-3 alpha/CCL20 (HEK293-expressed)
HY-P0089A Human growth hormone-releasing factor TFA HY-P7262 Recombinant Human MIP-3 alpha/CCL20
HY-P1163A D[LEU4,LYS8]-VP TFA HY-P7263 Recombinant Mouse Macrophage Inflammatory Protein-3 alpha/CCL20
HY-P0063 Copper tripeptide HY-P7264 Recombinant Mouse Macrophage Inflammatory Protein-3 beta/CCL19
HY-P1244 Secretin (33-59), rat HY-P7265 Recombinant Human MIP-4/CCL18
HY-P1792 Angiotensin II (1-4), human HY-P7266 Recombinant Human MIP-5/CCL15
HY-P0054B GLP-1(7-36), amide TFA HY-P7267 Recombinant Human Neutrophil Activating Peptide-2/CXCL7 (CHO-expressed)
HY-P1076 CALP2 HY-P7268 Recombinant Human Neutrophil Activating Peptide-2/CXCL7
HY-P2508 MUC1, mucin core HY-P7269 Recombinant Rat NAP-2/CXCL7
HY-P0282 TAT peptide HY-P7270 Recombinant Human Neuroserpin (CHO-expressed)
HY-131109 Cyclo(Gly-Tyr) HY-P7271 Recombinant Human NGF Receptor (HEK293-expressed)
HY-P0205B Saralasin TFA HY-P7272 Recombinant Human Neurotrophin-4
HY-P0173B Chlorotoxin TFA HY-P7273 Recombinant Mouse Neurotrophin-4
HY-P1211 Adrenocorticotropic Hormone (ACTH) (1-39), human HY-P7274 Recombinant Mouse Oncostatin M (HEK293-expressed)
HY-P1768 Urechistachykinin I HY-P7275 Recombinant Mouse Oncostatin M
HY-P2410 Fmoc-Ile-Ser(psi(Me,Me)pro)-OH HY-P7276 Recombinant Human Otoraplin
HY-P1324A [cPP1-7,NPY19-23,Ala31,Aib32,Gln34]-hPancreatic polypeptide TFA HY-P7277 Recombinant Mouse Platelet-Derived Growth Factor-AA
HY-P2552 Histone H3 (1-21) HY-P7278 Recombinant Rat Platelet-Derived Growth Factor-BB
HY-P1510 β-amyloid 1-11 HY-P7279 Recombinant Human PDGF-CC (HEK293-expressed)
HY-P7061 ALX 40-4C HY-P7280 Recombinant Human PDGF-DD (CHO-expressed)
HY-P1306 Obestatin(rat) HY-P7281 Recombinant Human Platelet factor-4/CXCL4 (HEK293-expressed)
HY-P2080 GIP (1-30) amide,human HY-P7282 Recombinant Human RANTES/CCL5 (HEK293-expressed)
HY-P1737 Conopressin S HY-P7283 Recombinant Human RANTES/CCL5
HY-P2625 GLP-2(3-33) HY-P7284 Recombinant Human Stromal-Cell Derived Factor-1 alpha/CXCL12
HY-P0170 TB500 HY-P7285 Recombinant Mouse Stromal-Cell Derived Factor-1 alpha/CXCL12
HY-P2323 Lactoferricin B (4-14), bovine TFA HY-P7286 Recombinant Rat Stromal-Cell Derived Factor-1 alpha/CXCL12
HY-P1012 [Sar9,Met(O2)11]-Substance P HY-P7287 Recombinant Human SDF-1 beta/CXCL12
HY-P0012 Aviptadil HY-P7288 Recombinant Mouse Sonic Hedgehog (CHO-expressed)
HY-P2287 Cortagine HY-P7290 Recombinant Mouse Sonic Hedgehog
HY-P1212 Cortistatin 14, human, rat HY-P7291 Recombinant Human SPARC
HY-P0186 Endomorphin 2 HY-P7292 Recombinant Human TARC/CCL17
HY-P0033A Argireline acetate HY-P7293 Recombinant Mouse TARC/CCL17
HY-P1507 Fibrinogen Binding Inhibitor Peptide HY-P7294 Recombinant Human TECK/CCL25
HY-P1793 α-Casein (90-95) HY-P7295 Recombinant Human Trefoil Factor-3
HY-P0018 Pepstatin HY-P7296 Recombinant Human Transforming Growth Factor alpha (CHO-expressed)
HY-P0210B DAMGO (TFA) HY-P7299 Recombinant Mouse Transforming Growth Factor beta2 (HEK293-expressed)
HY-P1871A Amylin (IAPP), feline TFA HY-P7301 Recombinant Rat ThymusChemokine-1/CXCL7 (CHO-expressed)
HY-P1799 [pTyr5] EGFR (988-993) HY-P7302 Recombinant Bovine Tumor Necrosis Factor alpha
HY-P2333A LCKLSL hydrochloride HY-P7303 Recombinant Rhesus Macaque Tumor Necrosis Factor alpha
HY-P1479 Calmodulin-Dependent Protein Kinase II (290-309) HY-P7304 Recombinant Human Tumor Necrosis Factor beta
HY-P1776 [pTyr1146][pTyr1150][pTyr1151]Insulin Receptor (1142-1153) HY-P7305 Recombinant Human Tumor Necrosis Factor type I (CHO-expressed)
HY-P1528 Autocamtide 2, amide HY-P7306 Recombinant Human TRAIL/Apo2L
HY-P1010A Z-LEHD-FMK TFA HY-P7307 Recombinant Human Tumor necrosis factor-related apoptosis-inducing ligand Receptor-2/TNFRSF10B (HEK293-expressed)
HY-P1238A Neuromedin U, rat TFA HY-P7308 Recombinant Human Tyrosine kinase receptor A (HEK293-expressed)
HY-P1880 β-Amyloid (12-20) HY-P7309 Recombinant Human TWEAK (CHO-expressed)
HY-P1846A Jagged-1 (188-204) (TFA) HY-P7311 Recombinant Rat VEGF165 (CHO-expressed)
HY-P2233 Globomycin HY-P7312 Recombinant Mouse VEGF165
HY-P1958 Histone H4 (2-21) HY-P7313 Recombinant Human VEGF-C (HEK293-expressed)
HY-P1588 Scyliorhinin II HY-P7314 Recombinant Human VEGF-D (HEK293-expressed)
HY-P1238 Neuromedin U, rat HY-P7315 Recombinant Human WISP-1 (CHO-expressed)
HY-P0316A TP508 TFA HY-P7155A Recombinant Human Dickkopf Related Protein-1 (HEK293-expressed)
HY-P1193 GR 82334 HY-P7316 Recombinant Human Epidermal Growth Factor Receptor, His (Sf9 insect cells-expressed)
HY-P2557 Histone H3 (5-23) HY-P7317 Recombinant Human 4-1BB, Fc Chimera (CHO-expressed)
HY-P1020 Nocistatin(human) HY-P7318 Recombinant Human Activation-inducible TNF-related Ligand/AITRL
HY-P1455 Adrenomedullin (AM) (1-52), human HY-P7319 Recombinant Mouse Activation-inducible TNF-related Ligand/AITRL
HY-103295A Lys-[Des-Arg9]Bradykinin TFA HY-P7320 Recombinant Mouse April/TNFSF13
HY-P0141 Akt/SKG Substrate Peptide HY-P7321 Recombinant Human B7-1/CD80, Fc Chimera (HEK293-expressed)
HY-P2294A pm26TGF-β1 peptide TFA HY-P7322 Recombinant Human B7-2/CD86, Fc Chimera (HEK293-expressed)
HY-P0201A Substance P TFA HY-P7323 Recombinant Human B7-2/CD86, Fc-His (HEK293-expressed)
HY-P0250 Kassinin HY-P7324 Recombinant Human B7-H2/ICOSLG, Fc Chimera (HEK293-expressed)
HY-138203 Z-LE(OMe)TD(OMe)-FMK HY-P7325 Recombinant Human B7-H2/ICOSLG, His (HEK293-expressed)
HY-P1021 Peptide YY (PYY) (3-36), human HY-P7326 Recombinant Human B7-H3/ICOSLG, Fc Chimera (HEK293-expressed)
HY-P1081A Acetyl-Calpastatin(184-210)(human) TFA HY-P7327 Recombinant Human B7-H3/ICOSLG, His (HEK293-expressed)
HY-P0036 Octreotide HY-P7328 Recombinant Human Betacellulin (HEK293-expressed)
HY-P2319 OVA-E1 peptide HY-P7329 Recombinant Mouse Betacellulin
HY-P2534 C-Peptide 2, rat HY-P7330 Recombinant Human basic Fibroblast Growth Factor, 145a.a.
HY-P0298A [Des-Arg9]-Bradykinin acetate HY-P7331 Recombinant Human basic Fibroblast Growth Factor, 154a.a.
HY-P0241 Neuromedin B HY-P7332 Recombinant Human Bone Morphogenetic Protein-3B
HY-P0302 HEX3 HY-P7333 Recombinant Human CD19, Fc Chimera (CHO-expressed)
HY-P0204 Endothelin-3, human, mouse, rabbit, rat HY-P7334 Recombinant Human CD28, Fc Chimera (HEK293-expressed)
HY-P2384 Fmoc-Glu(OtBu)-Ser(psi(Me,Me)pro)-OH HY-P7335 Recombinant Human CD47, Fc Chimera (HEK293-expressed)
HY-P1607 Nisin HY-P7336 Recombinant Human CD47, His (HEK293-expressed)
HY-P1976 Diphtheria toxin CRM197 HY-P7337 Recombinant Mouse DCIP-1/CXCL3 (CHO-expressed)
HY-P1474A β-Amyloid (22-35) (TFA) HY-P7338 Recombinant Human Desert Hedgehog
HY-P1065A Apelin-36(rat, mouse) TFA HY-P7339 Recombinant Mouse Desert Hedgehog
HY-P2159 Dynorphin A (1-8) HY-P7340 Recombinant Human EGF Receptor, His (CHO-expressed)
HY-N2466 Melanotan I HY-P7341 Recombinant Bovine Enterokinase, His (P.pastoris-expressed)
HY-P2633 Dentonin HY-P7342 Recombinant Human Fibroblast Growth Factor 10, His
HY-P1557 Somatostatin-28 1-12 HY-P7343 Recombinant Human Fibroblast Growth Factor 12
HY-P1449A Boc-Gly-Gly-Phe-Gly-OH TFA HY-P7344 Recombinant Human Fibroblast Growth Factor 16 (CHO-expressed)
HY-P1335A CTAP TFA HY-P7345 Recombinant Human Fibroblast Growth Factor 21, His (CHO-expressed)
HY-P1447 Exendin-3/4 (64-86) HY-P7346 Recombinant Human Fibroblast Growth Factor 8
HY-P1189A Echistatin TFA HY-P7347 Recombinant Human Fibroblast Growth Factor 8a
HY-P0009B Cetrorelix diacetate HY-P7348 Recombinant Mouse Fibroblast Growth Factor 8c
HY-P1581 Ceratotoxin A HY-P7349 Recombinant Human Fibroblast Growth Factor 8e
HY-106224A Orexin A (human, rat, mouse) (TFA) HY-P7350 Recombinant Human Fibroblast Growth Factor 8f
HY-P2291 Beta-defensin 103 isoform X1, pig HY-P7351 Recombinant Mouse Fibroblast Growth Factor 9 (CHO-expressed)
HY-P1192 GR-73632 HY-P7352 Recombinant Mouse Fibroblast Growth Factor 9
HY-P1194 Spantide I HY-P7353 Recombinant Human FGFR-1 alpha, Fc Chimera (Sf9 insect cells-expressed)
HY-P0274A PGLa TFA HY-P7354 Recombinant Mouse Flt-3 Ligand, His (CHO-expressed)
HY-P1369A DynaMin inhibitory peptide, myristoylated TFA HY-P7355 Recombinant Human Fractalkine/CX3CL1 (CHO-expressed)
HY-17609 Difelikefalin HY-P7356 Recombinant Rat Fractalkine/CX3CL1 (HEK293-expressed)
HY-P0273 Histatin 5 HY-P7357 Recombinant Human gAcrp30/Adipolean
HY-P1833 Egg Laying Hormone, aplysia HY-P7358 Recombinant Mouse gAcrp30/Adipolean
HY-P1149A Epitalon TFA HY-P7359 Recombinant Mouse Glial-Derived Neurotrophic Factor (CHO-expressed)
HY-P1217A [D-Trp8]-γ-MSH TFA HY-P7360 Recombinant Human Growth Hormone (CHO-expressed)
HY-P0272A Peptide T TFA HY-P7361 Recombinant Mouse Granulocyte Macrophage Colony Stimulating Factor
HY-P0076 TAK-448 HY-P7362 Recombinant Human Glia Maturation Factor beta
HY-P2093B S961 acetate HY-P7363 Recombinant Human GRO/CXCL1 (CHO-expressed)
HY-P2467 Biotin-TAT (47-57) HY-P7364 Recombinant Rat GRO alpha/CXCL1 (HEK293-expressed)
HY-P1754 Tetanus toxin (830-843) HY-P7365 Recombinant Human Heregulin-1 beta1
HY-P1202A CYN 154806 TFA HY-P7366 Recombinant Human HVEM, Fc Chimera (Sf9 insect cells-expressed)
HY-P1525 Melanin Concentrating Hormone, salmon HY-P7367 Recombinant Human IFN-gamma Receptor II (CHO-expressed)
HY-P1289 [Ala113]MBP(104-118) HY-P7368 Recombinant Human Insulin-like growth factor-binding protein 2, His (HEK-expressed)
HY-P1482A α-Factor Mating Pheromone, yeast TFA HY-P7369 Recombinant Human Insulin-like growth factor-binding protein 4, His (HEK-expressed)
HY-P2361A S12 TFA HY-P7370 Recombinant Rat Interleukin-12 (CHO-expressed)
HY-P2288A WL47 TFA HY-P7371 Recombinant Human Interleukin-15, His
HY-P1015 VIP(Guinea pig) HY-P7372 Recombinant Mouse Interleukin-17A (CHO-expressed)
HY-P0212 Neuropeptide Y, porcine HY-P7373 Recombinant Human Interleukin-17A, His (CHO-expressed)
HY-P1520 Prolactin Releasing Peptide (1-31), human HY-P7374 Recombinant Human Interleukin-2 Receptor alpha/CD25, Fc Chimera (HEK293-expressed)
HY-P1895 β-Amyloid (33-40) HY-P7375 Recombinant Rat Interleukin-3, His (CHO-expressed)
HY-P2657 Verucopeptin HY-P7376 Recombinant Rat Interleukin-3 beta
HY-P1601 Neuropeptide Y(29-64) HY-P7377 Recombinant Human Interleukin-6 Receptor alpha (Sf9 insect cells-expressed)
HY-P1271A Catestatin TFA HY-P7378 Recombinant Mouse Interleukin-6, His (CHO-expressed)
HY-P0234 Neurotensin HY-P7379 Recombinant Human Interleukin-8/CXCL8 (CHO-expressed)
HY-P0012A Aviptadil acetate HY-P7380 Recombinant Human Interleukin-8/CXCL8, 72a.a.
HY-P2549 Biotin-β-Amyloid (1-40) HY-P7381 Recombinant Human Kallikrein-11 (Sf9 insect cells-expressed)
HY-P1873 Phosphorylase Kinase β-Subunit Fragment (420-436) HY-P7382 Recombinant Human Keratinocyte Growth Factor/FGF-7, His
HY-P1454A Fz7-21 TFA HY-P7383 Recombinant Mouse LIX/CXCL5, 74a.a. (CHO-expressed)
HY-P0309 Arg-Gly-Glu-Ser HY-P7384 Recombinant Rat LIX/CXCL5, 88a.a. (CHO-expressed)
HY-P0295 Gly-Arg-Gly-Asp-Ser HY-P7385 Recombinant Human Maspin
HY-P0265 β-Amyloid (1-40) HY-P7386 Recombinant Rat Macrophage Colony Stimulating Factor
HY-P1589 β-catenin peptide HY-P7387 Recombinant Human Macrophage Migration Inhibitory Factor
HY-P1465 Secretin (28-54), human HY-P7388 Recombinant Mouse Macrophage Migration Inhibitory Factor
HY-P2452 Vitronectin (367-378) HY-P7389 Recombinant Human Macrophage Inflammatory Protein-1 beta/CCL4 (CHO-expressed)
HY-P1309A PAR-4 Agonist Peptide, amide TFA HY-P7390 Recombinant Human MPIF/CCL23, 85a.a. (CHO-expressed)
HY-P0253 Xenopsin HY-P7391 Recombinant Human NANOG-TAT
HY-100538A DTP3 TFA HY-P7392 Recombinant Human Nephroblastoma Overexpressed Gene Protein (CHO-expressed)
HY-P0031 Cyclo(RADfK) HY-P7393 Recombinant Human Otoraplin (CHO-expressed)
HY-P1596 Gluten Exorphin C HY-P7394 Recombinant Human OX40/TNFRSF4, His (HEK293-expressed)
HY-P1717A AMY-101 TFA HY-P7395 Recombinant Human PD-1, Fc Chimera (CHO-expressed)
HY-P1191 JIP-1(153-163) HY-P7396 Recombinant Human PD-1, His (HEK293-expressed)
HY-P1499 Somatostatin-28 1-14 HY-P7397 Recombinant Human PD-L1, Fc Chimera (CHO-expressed)
HY-P1823 C-Reactive Protein (CRP) (174-185) HY-P7398 Recombinant Human PD-L1, His (HEK293-expressed)
HY-P1180 Pam3CSK4 HY-P7399 Recombinant Human PD-L2, Fc Chimera (HEK293-expressed)
HY-P1376A G-Protein antagonist peptide TFA HY-P7400 Recombinant Human Proheparin-binding EGF-like Growth Factor (CHO-expressed)
HY-P1156 Insulin(cattle) HY-P7401 Recombinant Human PVR/CD155, Fc Chimera (HEK293-expressed)
HY-P2505 Syk Kinase Peptide Substrate HY-P7402 Recombinant Human PVR/CD155, His (HEK293-expressed)
HY-P1201 Cyclosomatostatin HY-P7403 Recombinant Mouse Stromal-Cell Derived Factor-1 alpha/CXCL12 (CHO-expressed)
HY-P1388 β-Amyloid (1-42), rat HY-P7404 Recombinant Mouse Stromal-Cell Derived Factor-1 beta/CXCL12 (CHO-expressed)
HY-P1790 Axltide HY-P7405 Recombinant Human Signal regulatory protein alpha, His (HEK293-expressed)
HY-P1828 EGFRvIII peptide (PEPvIII) HY-P7406 Recombinant Human Signal regulatory protein alpha, Fc Chimera (HEK293-expressed)
HY-P1291 PKI 14-22 amide,myristoylated HY-P7407 Recombinant Human Sonic Hedgehog, C24II
HY-P1269A α-Conotoxin AuIB TFA HY-P7408 Recombinant Human Sonic Hedgehog, C24IVI
HY-P1339A Orexin B, human TFA HY-P7409 Recombinant Mouse Sonic Hedgehog, C25II
HY-P1875A TNF-α (46-65), human TFA HY-P7410 Recombinant Human Surfactant protein-D (HEK293-expressed)
HY-P1313A PAR 4 (1-6) (TFA) HY-P7411 Recombinant Human Transforming Growth Factor alpha
HY-P1246 Neuropeptide AF (human) HY-P7412 Recombinant Rat Thrombopoietin, His (CHO-expressed)
HY-P1114A 2B-(SP) (TFA) HY-P7413 Recombinant Mouse Thrombopoietin, His (HEK293-expressed)
HY-P1532 Pancreatic Polypeptide, rat HY-P7414 Recombinant Human TIGIT, Fc Chimera (HEK293-expressed)
HY-P1800A Caerulein, desulfated TFA HY-P7416 Recombinant Human Tumor Necrosis Factor alpha, His
HY-P1346 APETx2 HY-P7417 Recombinant Mouse Tumor Necrosis Factor alpha, His
HY-P1546 Bombinin-Like Peptide BLP-1 HY-P7418 Recombinant Human Twisted Gastrulation, His
HY-P2022 Pentetreotide HY-P7419 Recombinant Human Vaspin
HY-P2387 Fmoc-Tyr(tBu)-Ser(psi(Me,Me)pro)-OH HY-P7420 Recombinant Human VEGF-121
HY-P2523 Temporin L HY-P7421 Recombinant Mouse VEGF164 (P.pastoris-expressed)
HY-P1079 ω-Agatoxin TK HY-P7415 Recombinant Human T Cell Immunoglobulin Mucin 3, Fc Chimera (HEK293-expressed)
HY-P1899 Smcy HY Peptide (738-746) HY-P7424 Recombinant Human RANK L/TNFSF11
HY-P1508A Bactenecin TFA HY-P7425 Recombinant Mouse RANK L/TNFSF11
HY-P2550 β-Amyloid (1-40), FAM-labeled HY-P7425A Recombinant Mouse RANK L/TNFSF11, His (CHO-expressed)
HY-P1731B Tirzepatide hydrochloride HY-P7422 Recombinant Human Thioredoxin/TXN, His
HY-P1305A CART(55-102)(rat) TFA HY-P7426 Recombinant Human Transforming growth factor-beta receptor type 2, C-Fc (HEK293-expressed)
HY-P0133A (Arg)9 TFA HY-P7427 Recombinant Mouse Transforming growth factor-beta receptor type 2, C-Fc (HEK293-expressed)
HY-P1843 Glycoprotein (276-286) HY-P7428 Recombinant Mouse Transforming growth factor-beta receptor type 2, His (HEK293-expressed)
HY-P0021 D-Lys(Z)-Pro-Arg-pNA HY-P7429 Recombinant 3C-like Proteinase, His
HY-P2080B GIP (1-30) amide,human acetate HY-P7431 Recombinant S Protein RBD Protein, His (HEK293-expressed)
HY-P1280 Margatoxin HY-P7432 Recombinant S protein RBD-SD1, C-mFc (HEK293-expressed)
HY-P1311 RLLFT-NH2 HY-P7433 Recombinant S protein RBD-SD1, His (HEK293-expressed)
HY-P2036A FSL-1 TFA HY-P7434 Recombinant S1 Protein, C-mFc (HEK293-expressed)
HY-P2243 D-JBD19 HY-P7435 Recombinant S1 Protein, C-Fc (HEK293-expressed)
HY-P1918A Activated Protein C (390-404), human TFA HY-P7436 Recombinant S1 Protein (HEK293-expressed)
HY-P1319 Nociceptin(1-7) HY-P7437 Recombinant Nucleocapsid Protein, His
HY-P1919 [Asp371]-Tyrosinase (369-377), human HY-P7438 Recombinant Nucleocapsid Protein NTD domain, His
HY-P1906A [pThr3]-CDK5 Substrate TFA HY-P7439 Recombinant Nucleocapsid Protein CTD domain, His
HY-P0058B Pramlintide acetate HY-P7441 Recombinant Human Angiotensin-Converting Enzyme 2, His (HEK293-expressed)
HY-P1511 PACAP-Related Peptide (PRP), human HY-P7442 Recombinant Human Angiotensin-Converting Enzyme 2, C-Fc (HEK293-expressed)
HY-106244 DOTATATE HY-P7443 Recombinant Human Angiotensin-Converting Enzyme 2, C-mFc (HEK293-expressed)
HY-P1098A Ac2-26 TFA HY-P7454 Recombinant Human Actin-related protein 8, His
HY-19870B Setmelanotide acetate HY-P7455 Recombinant Human Activin receptor type 2A, His (HEK293-expressed)
HY-P0138A MART-1 (26-35) (human) TFA HY-P7456 Recombinant Human Activin receptor type 2B, His (HEK293-expressed)
HY-P1592A G3-C12 TFA HY-P7457 Recombinant Human ACY3, His
HY-P1091A Hemopressin(human, mouse) TFA HY-P7458 Recombinant Human Acylphosphatase-1, His
HY-P1805 Calmodulin Binding Peptide 1 HY-P7459 Recombinant Human Acylphosphatase-2, N-GST
HY-P2344A HIV Protease Substrate 1 TFA HY-P7460 Recombinant Human ADAM-like protein decysin-1, His (HEK293-expressed)
HY-P1144A Oxyntomodulin TFA HY-P7461 Recombinant Mouse Adiponectin, His (HEK293-expressed)
HY-P1279 [Lys5,MeLeu9,Nle10]-NKA(4-10) HY-P7462 Recombinant Human ADP-ribosylarginine hydrolase, His
HY-P0179 β-Casomorphin, bovine HY-P7463 Recombinant Human Alpha-Fetoprotein, His (HEK293-expressed)
HY-P1769 Angiotensin II (5-8), human HY-P7464 Recombinant Mouse Alpha-Fetoprotein, His (HEK293-expressed)
HY-P1476A Adrenocorticotropic Hormone (ACTH) (18-39), human TFA HY-P7465 Recombinant Human AG-2, His (HEK293-expressed)
HY-P0007A Elcatonin acetate HY-P7466 Recombinant Human AG-3, His (HEK293-expressed)
HY-P1858A Urocortin III, mouse TFA HY-P7467 Recombinant Human AGER, His (HEK293-expressed)
HY-P2123A Colistin A sulfate hydrate HY-P7468 Recombinant Mouse Agr3, His (HEK293-expressed)
HY-P2290 Beta-defensin 1, pig HY-P7469 Recombinant Human Aldo-keto reductase family 1 member C2
HY-P1740A RGD peptide (GRGDNP) (TFA) HY-P7470 Recombinant Human Aldo-keto Reductase 1C4, His
HY-P1142 GLP-2(rat) HY-P7471 Recombinant Human CD166, C-Fc (HEK293-expressed)
HY-P1009 Z-YVAD-FMK HY-P7472 Recombinant Mouse CD166, C-Fc (HEK293-expressed)
HY-P2495 OVA (241-270) HY-P7473 Recombinant Human ADH7, His (HEK293-expressed)
HY-P1023 VIP(6-28)(human, rat, porcine, bovine) HY-P7474 Recombinant Human Aldehyde Dehydrogenase 1-A1, His
HY-P2297A TfR-T12 TFA HY-P7475 Recombinant Human Aldehyde Dehydrogenase 1-A2, His 
HY-P1043A NGR peptide Trifluoroacetate HY-P7476 Recombinant Human Aldehyde Dehydrogenase 1-A3, His
HY-P0058 Pramlintide HY-P7477 Recombinant Human Aldehyde dehydrogenase family 3 member A1, His (HEK293-expressed)
HY-P1746A Protein Kinase C (19-31) (TFA) HY-P7478 Recombinant Human Fructose-bisphosphate aldolase C, His (HEK293-expressed)
HY-P1045A 187-1, N-WASP inhibitor TFA HY-P7479 Recombinant Human Aldose 1-epimerase, His
HY-P0182 NH2-KLGADTDGEQDQHMTYGGQ-COOH HY-P7480 Recombinant Human Activin Receptor-like Kinase 1, C-Fc (HEK293-expressed)
HY-W019721 Cyclosporin D HY-P7481 Recombinant Mouse Activin Receptor-like Kinase 1, C-Fc (HEK293-expressed)
HY-15664 Bivalirudin TFA HY-P7482 Recombinant Human Activin RIA, His (HEK293-expressed)
HY-P0299A LSKL, Inhibitor of Thrombospondin (TSP-1) (TFA) HY-P7483 Recombinant Mouse BMPR1A, C-Fc-His (HEK293-expressed)
HY-P3061 [Hyp3]-Bradykinin HY-P7484 Recombinant Human BMPR1A, C-Fc-His (HEK293-expressed)
HY-P1905 [Gln8]-C517 (LH-RH), chicken HY-P7485 Recombinant Human Activin Receptor IB, His (HEK293-expressed)
HY-P0323 GP(33-41) HY-P7486 Recombinant Mouse Activin Receptor IB, C-Fc (HEK293-expressed)
HY-P2490 Acetyl-Hirudin (54-65) (sulfated) HY-P7487 Recombinant Human Alkaline Phosphatase, His (HEK293-expressed)
HY-P2533 Proinsulin C-Peptide (31-63), porcine HY-P7488 Recombinant Human Allograft inflammatory factor 1, His
HY-P1813 PSA1 (141-150) HY-P7489 Recombinant Human Alpha 1-Microglobulin, His (HEK293-expressed)
HY-P1682A Balixafortide TFA HY-P7490 Recombinant Human alpha-1-acid glycoprotein 2, His (HEK293-expressed)
HY-P1066A Apelin-17(human, bovine) TFA HY-P7491 Recombinant Mouse Alpha-1-antitrypsin 1-1, His (HEK293-expressed)
HY-P1770A Adrenomedullin (16-31), human TFA HY-P7492 Recombinant Human alpha-Galactosidase A, His (HEK293-expressed)
HY-P1533A CRF, bovine TFA HY-P7493 Recombinant Human alpha-Parvin, His
HY-P2555 Histone H3 (23-34) HY-P7494 Recombinant Human Ameloblastin, His (HEK293-expressed)
HY-P0191 Charybdotoxin HY-P7495 Recombinant Human Amphoterin-Induced Protein 2, His (HEK293-expressed)
HY-P0089 Human growth hormone-releasing factor HY-P7496 Recombinant Human Amphoterin-Induced Protein 2, C-Fc (HEK293-expressed)
HY-P1534 Adrenomedullin (1-50), rat HY-P7497 Recombinant Human Amiloride-binding protein 1, His (HEK293-expressed)
HY-P2328 Gramicidin C HY-P7498 Recombinant Human Aminopeptidase P1, His
HY-P2298 TAT-P4-(DATC5)2 HY-P7499 Recombinant Human Aminopeptidase P2, His (HEK293-expressed)
HY-P1422 Spadin HY-P7500 Recombinant Human Alpha-amylase 2B, His (HEK293-expressed)
HY-P0320 EGF Receptor Substrate 2 Phospho-Tyr5 HY-P7501 Recombinant Human Amyloid Precursor, C-Fc (HEK293-expressed)
HY-P1333A Dynorphin A TFA HY-P7502 Recombinant Human Amyloid-like Protein 1, His (HEK293-expressed)
HY-P1912 Alpha 1(I) Collagen (614-639), human HY-P7503 Recombinant Human Angiogenin
HY-P1675A Acetyl-PHF6 amide TFA HY-P7504 Recombinant Mouse Angiopoietin-like Protein 3, His (HEK293-expressed)
HY-P2547 Tyrosine Kinase Peptide 1 HY-P7505 Recombinant Human Angiopoietin-like Protein 3, His (HEK293-expressed)
HY-P1195 PDZ1 Domain inhibitor peptide HY-P7506 Recombinant Human Angiopoietin-like Protein 8, N-Fc (HEK293-expressed)
HY-P1366 des-​Gln14-​Ghrelin HY-P7507 Recombinant Human Angiopoietin-Related Protein 4, His (HEK293-expressed)
HY-P0300 Bak BH3 HY-P7508 Recombinant Mouse Angiopoietin-Related Protein 4, C-Fc (HEK293-expressed)
HY-P0292 GnRH-I HY-P7509 Recombinant Human Angiopoietin-related Protein 7, His (HEK293-expressed)
HY-P2307 Tat-NR2Baa HY-P7510 Recombinant Human Angiopoietin-2, His (HEK293-expressed)
HY-P0060 Tetracosactide HY-P7511 Recombinant Human SB13, His
HY-P1249A Neuropeptide SF(mouse,rat) TFA HY-P7512 Recombinant Human Annexin A1
HY-P0270 Magainin 2 HY-P7513 Recombinant Human Annexin A10
HY-P2281 Atrial natriuretic factor (1-28) (human, porcine) HY-P7514 Recombinant Human Annexin A13
HY-P1393A AC 187 TFA HY-P7515 Recombinant Human Annexin A2
HY-P1064 Apelin-36(human) HY-P7516 Recombinant Human Annexin A3
HY-P1312A LRGILS-NH2 TFA HY-P7517 Recombinant Human Annexin A5
HY-P1070A Amylin, amide, human TFA HY-P7518 Recombinant Human Annexin A6, His
HY-P0281 TAT HY-P7519 Recombinant Human Annexin A7
HY-P1391 ZIP(Scrambled) HY-P7520 Recombinant Human Annexin A8
HY-P2544 [Lys8, Lys9]-Neurotensin (8-13) HY-P7521 Recombinant Human Anthrax toxin receptor 1, His (HEK293-expressed)
HY-P1363 β-Amyloid (1-42), human TFA HY-P7522 Recombinant Human APBA3, His
HY-P1495 Small Cardioactive Peptide B SCPB HY-P7523 Recombinant Human APE
HY-P1560 Allergen Gal d 4 (46-61), chicken HY-P7524 Recombinant Human ApolipoproteinB-100, His
HY-P1322 [D-Trp34]-Neuropeptide Y HY-P7525 Recombinant Human Apolipoprotein A-I, His (HEK293-expressed)
HY-P0074A GPRP acetate HY-P7526 Recombinant Human Apolipoprotein A-I
HY-P1580 PA (224-233), Influenza HY-P7527 Recombinant Human Apolipoprotein A-II, His (HEK293-expressed)
HY-P2392 Fmoc-Ala-Thr(psi(Me,Me)pro)-OH HY-P7528 Recombinant Human Apolipoprotein A-IV, His (HEK293-expressed)
HY-A0162A Quinupristin mesylate HY-P7530 Recombinant Human Apolipoprotein D, His (HEK293-expressed)
HY-P3139 TPP-1 HY-P7531 Recombinant Human Apolipoprotein E, His (HEK293-expressed)
HY-P2537 Apelin-12 HY-P7532 Recombinant Mouse Apolipoprotein E, His (HEK293-expressed)
HY-P1345A TLQP-21 TFA HY-P7533 Recombinant Human Apolipoprotein H, His (HEK293-expressed)
HY-P0064 Palmitoyl Tetrapeptide-3 HY-P7534 Recombinant Mouse Apolipoprotein H, His (HEK293-expressed)
HY-P1390 d[Cha4]-AVP HY-P7535 Recombinant Human Apolipoprotein J, C-Fc-His (HEK293-expressed)
HY-P1826 CLIP (86-100) HY-P7536 Recombinant Human Apolipoprotein M, His (HEK293-expressed)
HY-P2401 Fmoc-Asn(Trt)-Ser(psi(Me,Me)pro)-OH HY-P7537 Recombinant Human Apoptosis Regulator Bcl-2, His
HY-P2553 Histone H3 (116-136), C116-136 HY-P7538 Recombinant Mouse APRIL/TNFSF13, N-Fc (HEK293-expressed)
HY-P0303 Crustacean Cardioactive Peptide CCAP HY-P7539 Recombinant Human APT-1, His
HY-P0219 Microcystin-LA HY-P7540 Recombinant Human ARC
HY-P1714A Apraglutide TFA HY-P7541 Recombinant Human Arginase-1, His
HY-P1913A Calcitonin Gene Related Peptide (CGRP) II, rat TFA HY-P7447 Recombinant Mouse 4-1BB/TNFRSF9, C-Fc (HEK293-expressed)
HY-P1118A Ac9-25 TFA HY-P7444 Recombinant Human Mannan-binding lectin serine protease 1, His (HEK293-expressed)
HY-P1383A Rac1 Inhibitor F56, control peptide TFA HY-P7445 Recombinant Human 14-3-3 protein epsilon, N-GST
HY-P1068 Lysozyme HY-P7529 Recombinant Human Apolipoprotein C-II, His
HY-P0311 LAH4 HY-P7446 Recombinant Mouse 4-1BB Ligand/TNFSF9, His (HEK293-expressed)
HY-P1341A OXA(17-33) TFA HY-P7448 Recombinant Mouse CD73, His (HEK293-expressed)
HY-P3102A GLP-1(32-36)amide TFA HY-P7449 Recombinant Rat CD73, His (HEK293-expressed)
HY-P1578A Galanin (1-16), mouse, porcine, rat TFA HY-P7450 Recombinant Human PGD, His (HEK293-expressed)
HY-P1318 Ac-RYYRIK-NH2 HY-P7451 Recombinant Human MCAD, His
HY-106178 PMX-53 HY-P7452 Recombinant Human Acyl-coenzyme A thioesterase 13, His (HEK293-expressed)
HY-P0136 SAMS HY-P7453 Recombinant Human ACTB, His
HY-P1300 [(pF)Phe4]Nociceptin(1-13)NH2 HY-P7542 Recombinant Human Serpin A1/alpha-1-Antitrypsin, His (HEK293-expressed)
HY-P1227 SDV-Exendin-3/4 HY-P9806 Anti-MERS-D12  mAb
HY-P1963 Ac-IEVDIDVEH TFA HY-P7544 Recombinant Mouse Interferon -alpha2
HY-P1423A BA 1 TFA HY-P7999  Recombinant Human PPAR-gamma-LBD, His
HY-P1391A ZIP(Scrambled) TFA HY-P7997  Recombinant Human PSMB5, His
HY-P1571 Nucleoprotein (396-404) HY-P7996  Recombinant Human PPARA, His
HY-P1163 D[LEU4,LYS8]-VP HY-P7994  Recombinant Human Bcl-2 (G101-V), His (HEK293-expressed)
HY-P1075 CALP3 HY-P7993  Recombinant Human Cathepsin B, His (HEK293-expressed)
HY-P1295 Urocortin, human HY-P7646 Recombinant Mouse BAFFR/TNFRSF13C, C-Fc (HEK293-expressed)
HY-P1072 PHM-27 (human) HY-P7647 Recombinant Human BAG2, His
HY-P1321 GR231118 HY-P7648 Recombinant Human BCAM, His (HEK293-expressed)
HY-P0190 Iberiotoxin HY-P7649 Recombinant Human BCAS2, His, N-T7
HY-P1503 ACTH 4-11 HY-P7603 Recombinant Human Arginase-2, His
HY-B2237 Lysozyme from chicken egg white HY-P7650 Recombinant Human Bcl-2-like protein 1, His
HY-P1233 ANQ-11125 HY-P7651 Recombinant Human BCL2L4, His
HY-P1585A Gp100 (25-33), human TFA HY-P7652 Recombinant Human Bcl-2-like Protein 11, His
HY-P1538A Fibrinopeptide A, human TFA HY-P7653 Recombinant Human Bcl-2-like protein 2, His
HY-N7122 Thymopentin HY-P7654 Recombinant Human BCMA/TNFRSF17, C-Fc (HEK293-expressed)
HY-P0304 CEF4 HY-P7655 Recombinant Human BCMA/TNFRSF17, His (P. Pichia-expressed)
HY-P1743 Acyl Carrier Protein (ACP) (65-74) HY-P7610 Recombinant Human Asialoglycoprotein Receptor 1, His (HEK293-expressed)
HY-P1448 Ac-Leu-Arg-AMC HY-P7656 Recombinant Mouse BCMA/TNFRSF17, C-Fc (HEK293-expressed)
HY-P1913 Calcitonin Gene Related Peptide (CGRP) II, rat HY-P7657 Recombinant Human Beta-Defensin 4A
HY-P1118 Ac9-25 HY-P7658 Recombinant Human BDH1, His
HY-P1469 Bradykinin (1-6) HY-P7604 Recombinant Human Aldo-Keto Reductase Family 1 Member C3, His (HEK293-expressed)
HY-P2312 Human β-defensin-3 HY-P7659 Recombinant Human BDH2, His
HY-P2171 CCP peptide HY-P7660 Recombinant Human Beta-Nerve Growth Factor (HEK293-expressed)
HY-P1509 Rhodopsin Epitope Tag HY-P7661 Recombinant Mouse Beta-Nerve Growth Factor
HY-P0049 Argipressin HY-P7662 Recombinant Human BID
HY-P1761 Prepro VIP (111-122), human HY-P7663 Recombinant Human Biglycan, His (HEK293-expressed)
HY-P2398 Fmoc-Phe-Ser(psi(Me,Me)pro)-OH HY-P7664 Recombinant Human Biliverdin Reductase A, His
HY-P1700 BCMA72-80 HY-P7665 Recombinant Human Bisphosphoglycerate mutase, His
HY-P0184A Camstatin TFA HY-P7666 Recombinant Human Fatty Acid-Binding Protein 7, His
HY-P1918 Activated Protein C (390-404), human HY-P7602 Recombinant Human Arginase-1, His (HEK293-expressed)
HY-P1038 [SER140]-PLP(139-151) HY-P7605 Recombinant Human ARMET/MANF, His (HEK293-expressed)
HY-P0236 Neurokinin A(4-10) HY-P7606 Recombinant Human ARRB1/beta-Arrestin 1, His
HY-P1781 Peptide C105Y HY-P7607 Recombinant Human Artemin
HY-P1883A Bacterial Sortase Substrate III, Abz/DNP TFA HY-P7608 Recombinant Human Arylsulfatase A, His (HEK293-expressed)
HY-P2355 {Boc}-Phe-Leu-Phe-Leu-Phe HY-P7609 Recombinant Human ASAM/CLMP, His (HEK293-expressed)
HY-19894 LTX-315 HY-P7611 Recombinant Human GOT1, His
HY-P0070 Thymus peptide C HY-P7612 Recombinant Human Asprosin, His (HEK293-expressed)
HY-P1329A CTOP TFA HY-P7613 Recombinant Human Argininosuccinate synthase, His
HY-P1176A NTR 368 TFA HY-P7614 Recombinant Human Additional Sex Combs-like Protein 1, N-GST
HY-P1436 Acetyl-pepstatin HY-P7615 Recombinant Human ATF1, His
HY-P0054A GLP-1(7-36), amide HY-P7616 Recombinant Human Autophagy Related 10 Homolog , His, N-T7
HY-P1269 α-Conotoxin AuIB HY-P7617 Recombinant Human Ubiquitin-like-conjugating Enzyme ATG3
HY-P1923 L-Asparaginase HY-P7618 Recombinant Human Autophagy Related 4 Homolog A, His
HY-P0197 Neurokinin A HY-P7619 Recombinant Human Autophagy Related 4 Homolog C, His
HY-P2106A Elabela(19-32) TFA HY-P7620 Recombinant Human Autophagy protein 5
HY-P0226 TFLLR-NH2 HY-P7621 Recombinant Human ATP-binding Cassette sub-family B Member 5, N-Trx
HY-P0214A Autocamtide-2-related inhibitory peptide TFA HY-P7622 Recombinant Human AXL, His (HEK293-expressed)
HY-P1462 Calcitonin Gene Related Peptide (CGRP) (83-119), rat HY-P7623 Recombinant Mouse AXL, His (HEK293-expressed)
HY-P1250 RFRP-3(human) HY-P7624 Recombinant Human Azurocidin, His (HEK293-expressed)
HY-P1773A IGF-I (30-41) (TFA) HY-P7625 Recombinant Human Beta-2-microglobulin, His
HY-P1116A PBP10 TFA HY-P7626 Recombinant Human B3GAT3, His
HY-P0141A Akt/SKG Substrate Peptide TFA HY-P7667 Recombinant Human B-Cell Linker Protein, His
HY-P1340 [Ala11,D-Leu15]-Orexin B(human) HY-P7668 Recombinant Human BMP1, His (HEK293-expressed)
HY-P1866A β-Endorphin, equine TFA HY-P7669 Recombinant Human BMPR2, His (HEK293-expressed)
HY-P0313 CEF6 HY-P7670 Recombinant Human BNIP3, His
HY-P1345 TLQP-21 HY-P7671 Recombinant Human BOC, His (HEK293-expressed)
HY-P0022A pGlu-Pro-Arg-MNA monoacetate HY-P7672 Recombinant Human Bone Marrow Proteoglycan, His (HEK293-expressed)
HY-P2292 Omiganan-FITC HY-P7673 Recombinant Human Bone marrow stromal antigen 2, His (HEK293-expressed)
HY-P1544 Cerebellin HY-P7674 Recombinant Mouse Bone Sialoprotein 2, His (HEK293-expressed)
HY-P1584 Nucleoprotein 118-126 HY-P7675 Recombinant Human Brain-specific angiogenesis inhibitor 3, His (HEK293-expressed)
HY-P1755 p53 (17-26) HY-P7676 Recombinant Human Brevican Core Protein, His (HEK293-expressed)
HY-N7122A Thymopentin acetate HY-P7677 Recombinant Human Bridging integrator 2, His
HY-P1303 CART(62-76)(human,rat) HY-P7678 Recombinant Human BTLA/CD272, His (HEK293-expressed)
HY-P0232 Fmoc-Thr[GalNAc(Ac)3-α-D]-OH HY-P7679 Recombinant Human BTLA/CD272, C-Fc (HEK293-expressed)
HY-P1512A Antioxidant peptide A TFA HY-P7680 Recombinant Mouse Butyrophilin Subfamily 1 Member A1, His (HEK293-expressed)
HY-P1211A Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) HY-P7681 Recombinant Human Butyrophilin Subfamily 2 Member A1, His (HEK293-expressed)
HY-P1240A Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat TFA HY-P7682 Recombinant Human Butyrophilin Subfamily 2 Member A2, C-Fc (HEK293-expressed)
HY-P1032 Angiotensin I (human, mouse, rat) HY-P7683 Recombinant Human Butyrophilin Subfamily 3 Member A1/CD277, C-Fc (HEK293-expressed)
HY-P1964 Ac-IEVDIDVE TFA HY-P7684 Recombinant Human Butyrophilin subfamily 3 member A2, His (HEK293-expressed)
HY-P1362 β-Amyloid (42-1), human HY-P7685 Recombinant Human Butyrophilin subfamily 3 member A3, His (HEK293-expressed)
HY-P2543 Neuropeptide Y (3-36) (human, rat) HY-P7686 Recombinant Mouse Butyrophilin-like Protein 2, His (HEK293-expressed)
HY-P2633A Dentonin TFA HY-P7687 Recombinant Human Butyrophilin-like 9, His (HEK293-expressed)
HY-P3103A PINT-87aa TFA HY-P7688 Recombinant Human BUP-1, His
HY-P1278 GR 64349 HY-P7689 Recombinant Human Butyrophilin, His (HEK293-expressed)
HY-P2320 IDR-1 HY-P7690 Recombinant Human Butyrylcholinesterase, His (HEK293-expressed)
HY-P1205A MCH(human, mouse, rat) TFA HY-P7691 Recombinant Human CD93, His (HEK293-expressed)
HY-P1293A Conantokin G TFA HY-P7692 Recombinant Human HABP1/C1QBP, His
HY-P2231A Cotadutide acetate HY-P7693 Recombinant Human C1QTNF1/CTRP1, His (HEK293-expressed)
HY-P1840 Galanin Receptor Ligand M35 HY-P7694 Recombinant Human PRADC1, His (HEK293-expressed)
HY-P1034 DAPTA HY-P7695 Recombinant Mouse C5a
HY-P1135A M1145 TFA HY-P7696 Recombinant Human CA125, His (HEK293-expressed)
HY-P1753 VIR-165 HY-P7697 Recombinant Human Cadherin-1/CD324, His (HEK293-expressed)
HY-P1478 Adrenocorticotropic Hormone (ACTH) (4-10), human HY-P7698 Recombinant Human Cadherin-11, His (HEK293-expressed)
HY-P1777 IGF-I (24-41) HY-P7699 Recombinant Human Cadherin-17, His (HEK293-expressed)
HY-P1365A α-Conotoxin MII TFA HY-P7700 Recombinant Human Cadherin-3, His (HEK293-expressed)
HY-P1565A Transdermal Peptide Disulfide TFA HY-P7701 Recombinant Mouse Cadherin-3, C-Fc (HEK293-expressed)
HY-P0020 Tos-Gly-Pro-Arg-ANBA-IPA HY-P7702 Recombinant Human Cadherin-6, C-Fc (HEK293-expressed)
HY-P1595 CREBtide HY-P7703 Recombinant Human Cadherin-6, His (HEK293-expressed)
HY-P0183 Nociceptin HY-P7704 Recombinant Human Cadherin-8, His (HEK293-expressed)
HY-P1142A GLP-2(rat) TFA HY-P7705 Recombinant Human Calcineurin Subunit B Type 1, His
HY-P2315 Human β-defensin-1 HY-P7706 Recombinant Human Calcitonin Gene-related Peptide 2, C-Fc (HEK293-expressed)
HY-125567 Antileukinate HY-P7707 Recombinant Human Calcitonin, His (HEK293-expressed)
HY-P1366A des-​Gln14-​Ghrelin TFA HY-P7708 Recombinant Human Calcitonin, His
HY-P1136A Gap19 TFA HY-P7709 Recombinant Human Calmegin, His (HEK293-expressed)
HY-P1728A Super-TDU (1-31) (TFA) HY-P7710 Recombinant Human Calmodulin
HY-P1564A [Sar1, Ile8]-Angiotensin II TFA HY-P7711 Recombinant Human Calnexin, His (HEK293-expressed)
HY-P1383 Rac1 Inhibitor F56, control peptide HY-P7712 Recombinant Human Calreticulin-3
HY-P2515 Transcriptional Intermediary Factor 2 (TIF2) (740-753) HY-P7713 Recombinant Human Calumenin, His (HEK293-expressed)
HY-P1519 Brain Natriuretic Peptide (1-32), rat HY-P7714 Recombinant Human CAMK1, His (HEK293-expressed)
HY-P0055A GLP-1(7-37) acetate HY-P7715 Recombinant Human CAMK1D, N-GST
HY-P1535A Secretin, porcine TFA HY-P7716 Recombinant Mouse Carbonic Anhydrase 12, His (HEK293-expressed)
HY-P1707A Tau protein (592-597), human TFA HY-P7717 Recombinant Mouse Carbonic Anhydrase 4, His (HEK293-expressed)
HY-P1818 Neuropeptide Y (22-36) HY-P7718 Recombinant Human Carbonic Anhydrase 1, His
HY-P1376 G-Protein antagonist peptide HY-P7719 Recombinant Human Carbonic Anhydrase 3, His
HY-P0314 Arg-Gly-Asp-Cys HY-P7720 Recombinant Human Carbonic Anhydrase 4, His
HY-P1811 Iα52 HY-P7721 Recombinant Human Carbonic Anhydrase 5B, His
HY-P1565 Transdermal Peptide Disulfide HY-P7722 Recombinant Human Carbonic Anhydrase 7, His
HY-P1179A Guanylin(human) TFA HY-P7723 Recombinant Human Carbonic Anhydrase 8, His
HY-P1206 CH 275 HY-P7724 Recombinant Human Carbonic Anhydrase 10, His (HEK293-expressed)
HY-P3124A BIM-23190 hydrochloride HY-P7725 Recombinant Human Carbonic Anhydrase 10, His
HY-P2282 APTSTAT3-9R HY-P7726 Recombinant Human Carbonic Anhydrase 13, His
HY-P0181 Microtubule-associated protein tau (26-44) HY-P7727 Recombinant Human Carbonic Anhydrase 14, His
HY-P2198 PAMP-12(human, porcine) HY-P7728 Recombinant Mouse Carbonic Anhydrase 14, His
HY-P1765 Galanin (1-19), human HY-P7729 Recombinant Human Carbonic Anhydrase 11, His (HEK293-expressed)
HY-P1074 SNX-482 HY-P7730 Recombinant Human Carboxylesterase 1, His (HEK293-expressed)
HY-P0078 TRAP-6 HY-P7731 Recombinant Mouse Carboxylesterase 5, His (HEK293-expressed)
HY-106263 Tyroserleutide HY-P7732 Recombinant Human Carboxypeptidase A1, His (HEK293-expressed)
HY-P1136 Gap19 HY-P7733 Recombinant Human Carboxypeptidase A2, His (HEK293-expressed)
HY-P1467 [Met5]-Enkephalin, amide HY-P7734 Recombinant Human Carboxypeptidase B1, His (HEK293-expressed)
HY-P2404 Fmoc-Asp(OtBu)-Thr(psi(Me,Me)pro)-OH HY-P7735 Recombinant Human Carboxypeptidase B2, His (HEK293-expressed)
HY-P1865 β-Casomorphin (1-6), bovine HY-P7736 Recombinant Human Carboxypeptidase E, His (HEK293-expressed)
HY-P2476 Peripheral Myelin P0 Protein (180-199), mouse HY-P7737 Recombinant Human Carboxypeptidase M, His (HEK293-expressed)
HY-P1966 Ac-IEVDID TFA HY-P7738 Recombinant Mouse Carboxypeptidase M, His (HEK293-expressed)
HY-P1160A Bay 55-9837 TFA HY-P7739 Recombinant Human Cardiotrophin-1, His
HY-P1247 Calcineurin autoinhibitory peptide HY-P7740 Recombinant Human Carnosine Dipeptidase 1, His (HEK293-expressed)
HY-P0257 Astressin HY-P7741 Recombinant Human Casein kinase I isoform gamma-2, His
HY-P1484 Bradykinin (1-7) HY-P7742 Recombinant Human Caspase-10, His
HY-P2155A BigLEN(rat) TFA HY-P7743 Recombinant Human Caspase-14, His
HY-P2391 Fmoc-Gln(Trt)-Ser(psi(Me,Me)pro)-OH HY-P7744 Recombinant Human Catalase
HY-P2469 Brain Natriuretic Peptide-45, mouse HY-P7745 Recombinant Human Cathepsin A, His (HEK293-expressed)
HY-105077A Nemifitide diTFA HY-P7747 Recombinant Mouse Cathepsin B, His (HEK293-expressed)
HY-P0194A NocII TFA HY-P7748 Recombinant Human Cathepsin D, His (HEK293-expressed)
HY-P2213 GPLGIAGQ HY-P7749 Recombinant Mouse Cathepsin D, His (HEK293-expressed)
HY-P2520 Influenza HA (110-119) HY-P7750 Recombinant Human Cathepsin E, His (HEK293-expressed)
HY-P0266 N-Acetyl-Ser-Asp-Lys-Pro HY-P7751 Recombinant Mouse Cathepsin E, His (HEK293-expressed)
HY-P1917 Uty HY Peptide (246-254) HY-P7752 Recombinant Mouse Cathepsin H, His (HEK293-expressed)
HY-P0021A D-Lys(Z)-Pro-Arg-pNA diacetate HY-P7753 Recombinant Mouse Cathepsin L, His (HEK293-expressed)
HY-P0290 GRGDSP HY-P7754 Recombinant Human Cathepsin L1, His (HEK293-expressed)
HY-P1879 β-Amyloid (18-28) HY-P7755 Recombinant Human Cathepsin L2, His (HEK293-expressed)
HY-P1955A Etelcalcetide hydrochloride HY-P7756 Recombinant Human Cathepsin S, His (HEK293-expressed)
HY-P1294 α-Helical CRF(9-41) HY-P7757 Recombinant Mouse Cathepsin S, His (HEK293-expressed)
HY-P0310 SV40 large T antigen NLS HY-P7758 Recombinant Human Cathepsin X, His (HEK293-expressed)
HY-P2321 TRAP-6 amide HY-P7759 Recombinant Human C-C Motif Chemokine 17, His (HEK293-expressed)
HY-P0239 HA Peptide HY-P7760 Recombinant Mouse C-C Motif Chemokine 24
HY-P1044A Spinorphin TFA HY-P7761 Recombinant Rat C-C Motif Chemokine 5, His
HY-P0244 Dermorphin HY-P7762 Recombinant Human Coiled-coil domain-containing protein 134, His (HEK293-expressed)
HY-P1120A WKYMVM TFA HY-P7763 Recombinant Human C-C Motif Chemokine 14, His (HEK293-expressed)
HY-107532 N-Nonyldeoxynojirimycin HY-P7764 Recombinant Mouse C-C Motif Chemokine 2
HY-P1274A ShK-Dap22 TFA HY-P7765 Recombinant Human C-C Motif Chemokine 23
HY-P1301A [Arg14,Lys15]Nociceptin TFA HY-P7766 Recombinant Human C-C Motif Chemokine 24, His (HEK293-expressed)
HY-P1603 ACTH 22-39 HY-P7767 Recombinant Human C-C motif chemokine 27
HY-P1024 GLP-2(1-33)(human) HY-P7768 Recombinant Mouse C-C Motif Chemokine 3, His
HY-P0322A GRGDSPK TFA HY-P7769 Recombinant Human C-C Motif Chemokine 3-Like 1, His (HEK293-expressed)
HY-P1787 β-Amyloid (4-10) HY-P7770 Recombinant Human C-C Motif Chemokine 8, His (HEK293-expressed)
HY-P1783A M2e, human TFA HY-P7771 Recombinant Mouse C-C Motif Chemokine 8, His (HEK293-expressed)
HY-P1480 Neuropeptide Y (13-36), amide, human HY-P7772 Recombinant Mouse C-C Motif Chemokine 9
HY-P1252 Parathyroid Hormone (1-34), bovine HY-P7773 Recombinant Human CCND2, His
HY-P1215A HS024 TFA HY-P7774 Recombinant Human CD100, His (HEK293-expressed)
HY-P1772 β-Amyloid (1-17) HY-P7775 Recombinant Human CD102, His (HEK293-expressed)
HY-P2373 Nattokinase HY-P7776 Recombinant Human CD105, Trx, His
HY-P1512 Antioxidant peptide A HY-P7777 Recombinant Human CD106, His (HEK293-expressed)
HY-P1543 Exendin-3 HY-P7778 Recombinant Human CD107a, His (HEK293-expressed)
HY-P0082A Glucagon (1-29), bovine, human, porcine hydrochloride HY-P7779 Recombinant Human CD107a, C-Fc (HEK293-expressed)
HY-P2492 Renin FRET Substrate I HY-P7780 Recombinant Human CD112, His (HEK293-expressed)
HY-P0248 Kemptide HY-P7781 Recombinant Mouse CD112, His (HEK293-expressed)
HY-P2416 Gastrin-1, rat HY-P7782 Recombinant Human CD113, His (HEK293-expressed)
HY-P0033 Argireline HY-P7783 Recombinant Human CD116, His (HEK293-expressed)
HY-P1498 Substance P, Free Acid HY-P7784 Recombinant Human CD122, C-Fc (HEK293-expressed)
HY-P0210 DAMGO HY-P7785 Recombinant Human CD127, C-Fc, His (HEK293-expressed)
HY-P1797A Sakamototide substrate peptide TFA HY-P7786 Recombinant Human CD14, His (HEK293-expressed)
HY-P1742 Gluten Exorphin B5 HY-P7787 Recombinant Human CD142, His (HEK293-expressed)
HY-125747 Actinomycin X2 HY-P7788 Recombinant Human CD150, His (HEK293-expressed)
HY-P2298A TAT-P4-(DATC5)2 TFA HY-P7789 Recombinant Mouse CD155, His (HEK293-expressed)
HY-P0254A Kisspeptin-10, human TFA HY-P7790 Recombinant Rhesus macaque CD155, His (HEK293-expressed)
HY-P1597A Malantide TFA HY-P7791 Recombinant Human CD157, His (HEK293-expressed)
HY-P1870 OVA sequence (323-336) HY-P7792 Recombinant Human CD157, C-Fc (HEK293-expressed)
HY-P1831 Proadrenomedullin (1-20), human HY-P7793 Recombinant Mouse CD157, His (HEK293-expressed)
HY-P1794 G280-9 HY-P7794 Recombinant Human CD158d, His (HEK293-expressed)
HY-P1540 Angiotensin III, human, mouse HY-P7795 Recombinant Rhesus macaque CD160, His (HEK293-expressed)
HY-P1902 Cardiotoxin Analog (CTX) IV (6-12) HY-P7796 Recombinant Human CD160,  C-Fc (HEK293-expressed)
HY-P0162 HCV-IN-4 HY-P7797 Recombinant Rhesus macaque CD160, C-Fc (HEK293-expressed)
HY-P2048A MOTS-c(human) acetate HY-P7798 Recombinant Human CD160, His (HEK293-expressed)
HY-P1036A Compstatin TFA HY-P7799 Recombinant Mouse CD160, His (HEK293-expressed)
HY-P0242 Neurokinin B HY-P7800 Recombinant Mouse CD162, C-Fc (HEK293-expressed)
HY-P1516A Angiogenin (108-122) (TFA) HY-P7801 Recombinant Human CD177, His (HEK293-expressed)
HY-16707 CH 5450 HY-P7802 Recombinant E. coli Thioredoxin/TXN, His
HY-P0249 Phe-Met-Arg-Phe, amide HY-P7803 Recombinant Human Pyruvate Kinase M2/PKM2, His
HY-P2299 Protein E7(43-62) HY-P7627 Recombinant Human B3GNT1, His (HEK293-expressed)
HY-P2250 ELA RR>GG HY-P7628 Recombinant Human B4GALT1, His (HEK293-expressed)
HY-P2466 Bax BH3 peptide (55-74), wild type HY-P7629 Recombinant Human B4GALT3, His (HEK293-expressed)
HY-P2288 WL47 HY-P7630 Recombinant Human B4GALT4, His (HEK293-expressed)
HY-123275 H-D-Phe-Pip-Arg-pNA HY-P7631 Recombinant Human B7 Homolog 6, His (HEK293-expressed)
HY-P0305 PrP 106-126 HY-P7632 Recombinant Mouse B7-1, C-Fc (HEK293-expressed)
HY-P1476 Adrenocorticotropic Hormone (ACTH) (18-39), human HY-P7633 Recombinant Mouse B7-1, His (HEK293-expressed)
HY-P1062A Lauryl-LF 11 TFA HY-P7634 Recombinant Rat B7-1, His (HEK293-expressed)
HY-P1396 GRK2i HY-P7635 Recombinant Mouse B7-2, C-Fc (HEK293-expressed)
HY-P0237A KKI-5 (TFA) HY-P7636 Recombinant Rat B7-2, His (HEK293-expressed)
HY-P2198A PAMP-12(human, porcine) TFA HY-P7637 Recombinant Rhesus macaque B7-2, His (HEK293-expressed) 
HY-P0088 Porcine dynorphin A(1-13) HY-P7638 Recombinant Mouse B7-2, His (HEK293-expressed) 
HY-P1144 Oxyntomodulin HY-P7639 Recombinant Mouse B7-H3, His (HEK293-expressed) 
HY-P1465A Secretin (28-54), human TFA HY-P7640 Recombinant Human B7-H4, C-Fc (HEK293-expressed) 
HY-P1545A ACTH (1-17) (TFA) HY-P7641 Recombinant Mouse B7-H4, C-Fc (HEK293-expressed)
HY-P2389 Fmoc-Lys(Boc)-Ser(psi(Me,Me)pro)-OH HY-P7642 Recombinant Rhesus macaque B7-H4, His (HEK293-expressed)
HY-P1538 Fibrinopeptide A, human HY-P7643 Recombinant Rhesus macaque B7-H4, C-Fc (HEK293-expressed)
HY-P1324 [cPP1-7,NPY19-23,Ala31,Aib32,Gln34]-hPancreatic Polypeptide HY-P7644 Recombinant Human Bactericidal Permeability-Increasing Protein, His (HEK293-expressed)
HY-P1760 Allatostatin IV HY-P7645 Recombinant Human Baculoviral Iap Repeat-Containing Protein 5
HY-P0295A Gly-Arg-Gly-Asp-Ser (TFA) HY-P7994A  Recombinant Human Bcl-2 (G101-V), GST, (HEK293-expressed)
HY-P0168 Cibinetide HY-K0010 Protease Inhibitor Cocktail
HY-W015977 Prion Protein 106-126 (human) HY-K0021 Phosphatase Inhibitor Cocktail I
HY-P1784 Secretin, canine HY-K0022 Phosphatase Inhibitor Cocktail II
HY-114424 H-Ile-Pro-Pro-OH HY-K0023 Phosphatase Inhibitor Cocktail III
HY-P1328A TAT-14 TFA HY-K0011 Protease Inhibitor Cocktail, mini-Tablet
HY-P1289A [Ala107]MBP(104-118) HY-K0301 Cell Counting Kit-8
HY-P0312 c-Myc Peptide Trifluoroacetate HY-K0501 SYBR Green qPCR Master Mix
HY-P0023 Cyclo(-RGDfK) HY-K0030 Deacetylase Inhibitor Cocktail
HY-P1778 HPV16 E7 (86-93) HY-K0202 Protein A/G Magnetic Beads
HY-P1082A Gap 26 TFA HY-K0200 Magnetic Stand
HY-P1243A C3bot(154-182) TFA HY-K0201 Anti-HA Magnetic Beads
HY-P1600 Tyr-Somatostatin-14 HY-K0206 Anti-c-Myc Magnetic Beads
HY-P0201 Substance P HY-E0001 Cooling Rack
HY-P2394 Fmoc-Ser(tBu)-Thr(psi(Me,Me)pro)-OH HY-K0208 Streptavidin Magnetic Beads
HY-P1871 Amylin (IAPP), feline HY-K0204 Protein G Magnetic Beads
HY-P0118A Disitertide TFA HY-K0203 Protein A Magnetic Beads
HY-P1393 AC 187 HY-K0510 RT Master Mix for qPCR
HY-P0051 Lecirelin HY-K0511 RT Master Mix for qPCR (gDNA digester plus)
HY-P1744 N-Formyl-Met-Leu-Phe-Lys HY-K1001 RIPA Lysis Buffer (Strong)
HY-P2297 TfR-T12 HY-K1004 SYBR Green I Nucleic Acid Gel Stain
HY-P0166A Alexamorelin Met 1 HY-K1005 Ultra High Sensitivity ECL Kit
HY-P1762 Influenza NP (147-155) HY-K1006 Penicillin-Streptomycin (100×), Sterile
HY-B0686A Eptifibatide acetate HY-K0521 SYBR Green qPCR Master Mix (High ROX)
HY-P1228 HAEGTFT HY-K0522 SYBR Green qPCR Master Mix (Low ROX)
HY-P2123 Colistin A HY-K0523 SYBR Green qPCR Master Mix (No ROX)
HY-P2222 DX600 TFA HY-K1007 Red Nucleic Acid Gel Stain (10,000×)
HY-P2219 CGGRGD HY-K0210 Ni-NTA His-Tag Purification Agarose
HY-P2564 Human PD-L1 inhibitor III HY-K0207 Anti-Flag Magnetic Beads
HY-P0062A Ziconotide TFA HY-K0221 Affinity Chromatography Column
HY-P0296 Gly-Phe-Arg HY-K1011 3-Color Prestained Protein Marker (10-190 kDa)
HY-P1062 Lauryl-LF 11 HY-K0901 AMCA Phalloidin
HY-P1078 Huwentoxin XVI HY-K0902 Fluorescein Phalloidin
HY-P2382 TRV120056 HY-K0903 Rhodamine Phalloidin
HY-111659A His-Pro hydrochloride HY-K0601 JC-1 Mitochondrial Membrane Potential Assay Kit
HY-P0324 Parasin I HY-K0701 Antibody/Protein Labeling Kit – FITC
HY-P1005 Ac-DEVD-AFC HY-K0531 2× PCR Master Mix (with Dye)
HY-P1738 [Sar9] Substance P HY-K0532 2× Fast PCR Master Mix (with Dye)
HY-P1423 BA 1 HY-K0205 Protein L Magnetic Beads
HY-P1277 GR 94800 HY-K0533 2× High-Fidelity PCR Master Mix
HY-P2460 SMAP-29 HY-K1012 Serum/Protein-Free Cell Freezing Medium
HY-P0131A Laminin (925-933)(TFA) HY-K0222 Anti-GST Magnetic Beads
HY-P1339 Orexin B, human HY-K0211 Glutathione Agarose
HY-P1757 HIV p17 Gag (77-85) HY-K0234 Glutathione Magnetic Agarose Beads
HY-P2464 Myosin H Chain Fragment, mouse